From AureoWiki
Jump to navigation Jump to search

NCBI: 03-AUG-2016

Summary[edit | edit source]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_02887
  • pan locus tag?: SAUPAN006235000
  • symbol: SAOUHSC_02887
  • pan gene symbol?: isaA
  • synonym:
  • product: immunodominant antigen A

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_02887
  • symbol: SAOUHSC_02887
  • product: immunodominant antigen A
  • replicon: chromosome
  • strand: -
  • coordinates: 2660684..2661385
  • length: 702
  • essential: no [1] DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGAAAAAGACAATTATGGCATCATCATTAGCAGTGGCATTAGGTGTAACAGGTTACGCA
    GCAGGTACAGGACATCAAGCACACGCTGCTGAAGTAAACGTTGATCAAGCACACTTAGTT
    GACTTAGCGCATAATCACCAAGATCAATTAAATGCAGCTCCAATCAAAGATGGTGCATAT
    GACATCCACTTTGTAAAAGATGGTTTCCAATATAACTTCACTTCAAATGGTACTACATGG
    TCATGGAGCTATGAAGCAGCTAATGGTCAAACTGCTGGTTTCTCAAACGTTGCAGGTGCA
    GACTACACTACTTCATACAACCAAGGTTCAAATGTACAATCAGTAAGCTACAATGCACAA
    TCAAGTAACTCAAACGTTGAAGCTGTTTCAGCTCCAACTTACCATAACTACAGCACTTCA
    ACTACTTCAAGTTCAGTGAGATTAAGCAATGGTAATACTGCAGGTGCTACTGGTTCATCA
    GCAGCTCAAATCATGGCTCAACGTACTGGTGTTTCAGCTTCTACATGGGCTGCAATCATC
    GCTCGTGAATCAAATGGTCAAGTAAATGCTTACAACCCATCAGGTGCTTCAGGTTTATTC
    CAAACTATGCCAGGTTGGGGTCCAACAAACACTGTTGACCAACAAATCAACGCAGCTGTT
    AAAGCATACAAAGCACAAGGTTTAGGTGCTTGGGGATTCTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    702

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAOUHSC_02887
  • symbol: SAOUHSC_02887
  • description: immunodominant antigen A
  • length: 233
  • theoretical pI: 6.62819
  • theoretical MW: 24203
  • GRAVY: -0.338197

Function[edit | edit source]

  • reaction:
    EC 3.2.-.-?  ExPASy
  • TIGRFAM:
  • TheSEED  :
    • Immunodominant staphylococcal antigen A precursor
  • PFAM:
    Lysozyme (CL0037) SLT; Transglycosylase SLT domain (PF01464; HMM-score: 28.6)
    and 3 more
    Transglycosylas; Transglycosylase-like domain (PF06737; HMM-score: 21.8)
    no clan defined FtsK_4TM; 4TM region of DNA translocase FtsK/SpoIIIE (PF13491; HMM-score: 13)
    DUF945; Bacterial protein of unknown function (DUF945) (PF06097; HMM-score: 6.9)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Extracellular
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0
    • Extracellular Score: 10
    • Internal Helices: 0
  • DeepLocPro: Extracellular
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.0006
    • Cell wall & surface Score: 0.0115
    • Extracellular Score: 0.9879
  • LocateP: N-terminally anchored (with CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: -0.17
    • Signal peptide possibility: 1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: GTGHQAHA
  • SignalP: Signal peptide SP(Sec/SPI) length 29 aa
    • SP(Sec/SPI): 0.994875
    • TAT(Tat/SPI): 0.002931
    • LIPO(Sec/SPII): 0.001546
    • Cleavage Site: CS pos: 29-30. AHA-AE. Pr: 0.9855
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKKTIMASSLAVALGVTGYAAGTGHQAHAAEVNVDQAHLVDLAHNHQDQLNAAPIKDGAYDIHFVKDGFQYNFTSNGTTWSWSYEAANGQTAGFSNVAGADYTTSYNQGSNVQSVSYNAQSSNSNVEAVSAPTYHNYSTSTTSSSVRLSNGNTAGATGSSAAQIMAQRTGVSASTWAAIIARESNGQVNAYNPSGASGLFQTMPGWGPTNTVDQQINAAVKAYKAQGLGAWGF

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas [2] [3]
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator: WalR*/YycF (activation) regulon
    WalR*/YycF(response regulator)important in cell wall homeostasis;  [5]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Roy R Chaudhuri, Andrew G Allen, Paul J Owen, Gil Shalom, Karl Stone, Marcus Harrison, Timothy A Burgis, Michael Lockyer, Jorge Garcia-Lara, Simon J Foster, Stephen J Pleasance, Sarah E Peters, Duncan J Maskell, Ian G Charles
    Comprehensive identification of essential Staphylococcus aureus genes using Transposon-Mediated Differential Hybridisation (TMDH).
    BMC Genomics: 2009, 10;291
    [PubMed:19570206] [WorldCat.org] [DOI] (I e)
  2. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  3. Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  4. 4.0 4.1 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)
  5. Sarah Dubrac, Ivo Gomperts Boneca, Olivier Poupel, Tarek Msadek
    New insights into the WalK/WalR (YycG/YycF) essential signal transduction pathway reveal a major role in controlling cell wall metabolism and biofilm formation in Staphylococcus aureus.
    J Bacteriol: 2007, 189(22);8257-69
    [PubMed:17827301] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]

A K Ziebandt, H Weber, J Rudolph, R Schmid, D Höper, S Engelmann, M Hecker
Extracellular proteins of Staphylococcus aureus and the role of SarA and sigma B.
Proteomics: 2001, 1(4);480-93
[PubMed:11681202] [WorldCat.org] [DOI] (P p)
Alexandra Resch, Ralf Rosenstein, Christiane Nerz, Friedrich Götz
Differential gene expression profiling of Staphylococcus aureus cultivated under biofilm and planktonic conditions.
Appl Environ Microbiol: 2005, 71(5);2663-76
[PubMed:15870358] [WorldCat.org] [DOI] (P p)
Melanie R Stapleton, Malcolm J Horsburgh, Emma J Hayhurst, Lynda Wright, Ing-Marie Jonsson, Andrej Tarkowski, John F Kokai-Kun, James J Mond, Simon J Foster
Characterization of IsaA and SceD, two putative lytic transglycosylases of Staphylococcus aureus.
J Bacteriol: 2007, 189(20);7316-25
[PubMed:17675373] [WorldCat.org] [DOI] (P p)
Mark J J B Sibbald, Theresa Winter, Magdalena M van der Kooi-Pol, G Buist, E Tsompanidou, Tjibbe Bosma, Tina Schäfer, Knut Ohlsen, Michael Hecker, Haike Antelmann, Susanne Engelmann, Jan Maarten van Dijl
Synthetic effects of secG and secY2 mutations on exoproteome biogenesis in Staphylococcus aureus.
J Bacteriol: 2010, 192(14);3788-800
[PubMed:20472795] [WorldCat.org] [DOI] (I p)