From AureoWiki
Jump to navigation Jump to search

NCBI: 03-AUG-2016

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_02698
  • pan locus tag?: SAUPAN005947000
  • symbol: SAOUHSC_02698
  • pan gene symbol?: tcyB
  • synonym:
  • product: amino acid ABC transporter permease

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_02698
  • symbol: SAOUHSC_02698
  • product: amino acid ABC transporter permease
  • replicon: chromosome
  • strand: -
  • coordinates: 2481281..2482000
  • length: 720
  • essential: no DEG other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGTTTCTAAATCTAAATAGCGAACAACAACATGCGCTAGATGCTGCAAAACAAGCTTTC
    GGACCTATGCTAGAAGGTTTGGTCAAATATTCAATTCCTATTACATTAGTTACATTTGTT
    TTAGGATTGATTATTGCATTATTTACAGCATTAATGCGAATTTCAACGAGTAAAATTTTA
    AGAAGTATTTCACGTGTCTATGTATCTATTATTCGAGGAACACCAATGATAGTACAACTA
    TTTATCATATTTTATGGTATTCCAGAATTAGGTAGATTATTAACAAATGACGCTGACAAC
    CAATGGACATTGGCACCTGTAGTGGCTGCTATTATTGGTTTATCATTAAATGTAGGTGCG
    TATGCTTCGGAAATTATTCGTGGCGGTATTATTTCTATACCGAAAGGACAAACAGAAGCT
    GCATATTCCATCGGTATGACGTATGGTCAAACGATACAACGTATCATTTTACCGCAGGCA
    ATTCGAGTGTCGATTCCTGCACTAGGTAATACATTTTTAAGTTTAATCAAAGATACATCA
    TTATTAGGATTTATTTTAGTGGCTGAAATGTTTAGAAAAGCTCAAGAAGTTGCGTCTACA
    ACATATGAATATTTAACAATTTATGTGTTAGTTGCGCTAATGTACTGGGTGGTATGCTTT
    ATTATTTCAATTATCCAAGGTATCTATGAATCTTATATTGAAAGAGGGTATCGCTCATGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SAOUHSC_02698
  • symbol: SAOUHSC_02698
  • description: amino acid ABC transporter permease
  • length: 239
  • theoretical pI: 9.13859
  • theoretical MW: 26442.2
  • GRAVY: 0.682427

⊟Function[edit | edit source]

  • TIGRFAM:
    ectoine/hydroxyectoine ABC transporter, permease protein EhuC (TIGR03004; HMM-score: 159.4)
    ectoine/hydroxyectoine ABC transporter, permease protein EhuD (TIGR03003; HMM-score: 138.3)
    and 7 more
    Metabolism Transport and binding proteins Amino acids, peptides and amines amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family (TIGR01726; HMM-score: 84)
    Metabolism Transport and binding proteins Anions phosphate ABC transporter, permease protein PstA (TIGR00974; HMM-score: 23.7)
    Metabolism Transport and binding proteins Anions phosphate ABC transporter, permease protein PstC (TIGR02138; HMM-score: 20.9)
    Metabolism Transport and binding proteins Anions phosphonate ABC transporter, permease protein PhnE (TIGR01097; HMM-score: 17.5)
    Cellular processes Cellular processes Chemotaxis and motility flagellar biosynthetic protein FliQ (TIGR01402; HMM-score: 15.1)
    Cellular processes Cellular processes Pathogenesis type III secretion protein, HrpO family (TIGR01403; HMM-score: 4.8)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type III secretion protein, HrpO family (TIGR01403; HMM-score: 4.8)
  • TheSEED  :
    • amino acid ABC transporter, permease protein
    Sulfur Metabolism Organic sulfur assimilation L-Cystine Uptake and Metabolism  L-Cystine ABC transporter, permease protein TcyB
  • PFAM:
    BPD_transp_1 (CL0404) BPD_transp_1; Binding-protein-dependent transport system inner membrane component (PF00528; HMM-score: 95.5)
    and 6 more
    no clan defined Bac_export_3; Bacterial export proteins, family 3 (PF01313; HMM-score: 16.1)
    WSS_VP; White spot syndrome virus structural envelope protein VP (PF12175; HMM-score: 11.9)
    DUF3377; Domain of unknown function (DUF3377) (PF11857; HMM-score: 11)
    Oxa1 (CL0376) EMC3_TMCO1; Integral membrane protein EMC3/TMCO1-like (PF01956; HMM-score: 8.7)
    no clan defined NEMP; NEMP family (PF10225; HMM-score: 7.6)
    TSPAN_4TM-like (CL0347) DUF4064; Protein of unknown function (DUF4064) (PF13273; HMM-score: 7.1)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 4
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 1
    • Cell wall & surface Score: 0
    • Extracellular Score: 0
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004341
    • TAT(Tat/SPI): 0.000217
    • LIPO(Sec/SPII): 0.001597
  • predicted transmembrane helices (TMHMM): 4

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MFLNLNSEQQHALDAAKQAFGPMLEGLVKYSIPITLVTFVLGLIIALFTALMRISTSKILRSISRVYVSIIRGTPMIVQLFIIFYGIPELGRLLTNDADNQWTLAPVVAAIIGLSLNVGAYASEIIRGGIISIPKGQTEAAYSIGMTYGQTIQRIILPQAIRVSIPALGNTFLSLIKDTSLLGFILVAEMFRKAQEVASTTYEYLTIYVLVALMYWVVCFIISIIQGIYESYIERGYRS

⊟Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas [1] [2]
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator: CymR* (repression) regulon
    CymR*(TF)important in Cysteine metabolism; RegPrecise    transcription unit transferred from N315 data RegPrecise 

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  2. ↑ Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  3. ↑ 3.0 3.1 3.2 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

⊟Relevant publications[edit | edit source]