From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS11725 [old locus tag: SACOL2228 ]
  • pan locus tag?: SAUPAN005691000
  • symbol: SACOL_RS11725
  • pan gene symbol?: rplX
  • synonym:
  • product: 50S ribosomal protein L24

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL_RS11725 [old locus tag: SACOL2228 ]
  • symbol: SACOL_RS11725
  • product: 50S ribosomal protein L24
  • replicon: chromosome
  • strand: -
  • coordinates: 2301617..2301934
  • length: 318
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NC_002951 (2301617..2301934) NCBI
  • BioCyc: SACOL_RS11725 BioCyc
  • MicrobesOnline: see SACOL2228

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGCATATCAAAAAAGGTGACAACGTTAAAGTTATCGCAGGTAAAGACAAAGGTAAAGAA
    GGTAAAGTAATTGCTACTCTACCTAAAAAAGACCGTGTCGTTGTGGAAGGTGTTAACATT
    ATGAAAAAACACCAAAAACCAACTCAATTAAATCCTGAAGGTGGAATCTTAGAAACAGAG
    GCAGCAATCCATGTTTCTAATGTACAATTATTGGACCCTAAAACAAACGAACCAACTCGT
    GTAGGTTACAAATTTGTTGATGGTAAAAAAGTTCGTATCGCTAAAAAATCTGGCGAAGAA
    ATTAAATCTAATAATTAA
    60
    120
    180
    240
    300
    318

Protein[edit | edit source]

Protein Data Bank: 4WCE
Protein Data Bank: 4WF9
Protein Data Bank: 4WFA
Protein Data Bank: 4WFB
Protein Data Bank: 5HKV
Protein Data Bank: 5HL7
Protein Data Bank: 5LI0
Protein Data Bank: 5ND8
Protein Data Bank: 5ND9
Protein Data Bank: 5NRG
Protein Data Bank: 5TCU

General[edit | edit source]

  • locus tag: SACOL_RS11725 [old locus tag: SACOL2228 ]
  • symbol: SACOL_RS11725
  • description: 50S ribosomal protein L24
  • length: 105
  • theoretical pI: 10.5873
  • theoretical MW: 11536.4
  • GRAVY: -0.722857

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uL24 (TIGR01079; HMM-score: 136.5)
    and 3 more
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uL24 (TIGR01080; HMM-score: 32.2)
    transcription elongation factor Spt5 (TIGR00405; HMM-score: 17.5)
    HAD phosphatase, family IIIB (TIGR01672; EC 3.1.3.-; HMM-score: 13.1)
  • TheSEED: see SACOL2228
  • PFAM:
    SH3 (CL0010) ribosomal_L24; Ribosomal proteins 50S L24/mitochondrial 39S L24 (PF17136; HMM-score: 106)
    and 6 more
    KOW; KOW motif (PF00467; HMM-score: 37.5)
    KOW7_SPT5; Transcription elongation factor SPT5, seventh KOW domain (PF23287; HMM-score: 19.5)
    KOW4_SPT5; Transcription elongation factor SPT5, fourth KOW domain (PF23291; HMM-score: 19)
    Ribosomal_uL24m-like; Large ribosomal subunit protein uL24m (PF22682; HMM-score: 18.5)
    no clan defined SPP1_Dit; Siphovirus-type tail component, C-terminal domain (PF22768; HMM-score: 15.3)
    SH3 (CL0010) KOW2_Spt5; Transcription elongation factor SPT5, second KOW domain (PF23284; HMM-score: 11.5)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9348
    • Cytoplasmic Membrane Score: 0.0001
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.0649
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.008389
    • TAT(Tat/SPI): 0.000477
    • LIPO(Sec/SPII): 0.002161
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MHIKKGDNVKVIAGKDKGKEGKVIATLPKKDRVVVEGVNIMKKHQKPTQLNPEGGILETEAAIHVSNVQLLDPKTNEPTRVGYKFVDGKKVRIAKKSGEEIKSNN

Experimental data[edit | edit source]

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]