From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS10780 [old locus tag: SACOL2059 ]
  • pan locus tag?: SAUPAN005340000
  • symbol: SACOL_RS10780
  • pan gene symbol?: mazE
  • synonym:
  • product: antitoxin MazE

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL_RS10780 [old locus tag: SACOL2059 ]
  • symbol: SACOL_RS10780
  • product: antitoxin MazE
  • replicon: chromosome
  • strand: -
  • coordinates: 2124574..2124744
  • length: 171
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NC_002951 (2124574..2124744) NCBI
  • BioCyc: SACOL_RS10780 BioCyc
  • MicrobesOnline: see SACOL2059

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    ATGTTATCTTTTAGTCAAAATAGAAGTCATAGCTTAGAACAATCTTTAAAAGAAGGATAT
    TCACAAATGGCTGATTTAAATCTCTCCCTAGCGAACGAAGCTTTTCCGATAGAGTGTGAA
    GCATGCGATTGCAACGAAACATATTTATCTTCTAATTCAACGAATGAATGA
    60
    120
    171

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL_RS10780 [old locus tag: SACOL2059 ]
  • symbol: SACOL_RS10780
  • description: antitoxin MazE
  • length: 56
  • theoretical pI: 3.83056
  • theoretical MW: 6251.76
  • GRAVY: -0.596429

Function[edit | edit source]

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Extracellular
    • Cytoplasmic Score: 0.24
    • Cytoplasmic Membrane Score: 0.05
    • Cellwall Score: 0.8
    • Extracellular Score: 8.91
    • Internal Helices: 0
  • DeepLocPro: Extracellular
    • Cytoplasmic Score: 0.1912
    • Cytoplasmic Membrane Score: 0.0078
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.8009
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.085783
    • TAT(Tat/SPI): 0.019413
    • LIPO(Sec/SPII): 0.012313
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MLSFSQNRSHSLEQSLKEGYSQMADLNLSLANEAFPIECEACDCNETYLSSNSTNE

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]