Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SAS067 [new locus tag: SA_RS10780 ]
- pan locus tag?: SAUPAN005340000
- symbol: SAS067
- pan gene symbol?: mazE
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAS067 [new locus tag: SA_RS10780 ]
- symbol: SAS067
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2121531..2121701
- length: 171
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1124773 NCBI
- RefSeq: NP_375177 NCBI
- BioCyc: see SA_RS10780
- MicrobesOnline: 104203 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGTTATCTTTTAGTCAAAATAGAAGTCATAGCTTAGAACAATCTTTAAAAGAAGGATAT
TCACAAATGGCTGATTTAAATCTCTCCCTAGCGAACGAAGCTTTTCCGATAGAGTGTGAA
GCATGCGATTGCAACGAAACATATTTATCTTCTAATTCAACGAATGAATGA60
120
171
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAS067 [new locus tag: SA_RS10780 ]
- symbol: SAS067
- description: hypothetical protein
- length: 56
- theoretical pI: 3.83056
- theoretical MW: 6251.76
- GRAVY: -0.596429
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- Programmed cell death antitoxin MazE
Regulation and Cell signaling Programmed Cell Death and Toxin-antitoxin Systems MazEF toxin-antitoxing (programmed cell death) system Programmed cell death antitoxin YdcDand 1 more - PFAM:
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Extracellular
- Cytoplasmic Score: 0.24
- Cytoplasmic Membrane Score: 0.05
- Cellwall Score: 0.8
- Extracellular Score: 8.91
- Internal Helices: 0
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0.1912
- Cytoplasmic Membrane Score: 0.0078
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.8009
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.085783
- TAT(Tat/SPI): 0.019413
- LIPO(Sec/SPII): 0.012313
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MLSFSQNRSHSLEQSLKEGYSQMADLNLSLANEAFPIECEACDCNETYLSSNSTNE
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]