From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS08785 [old locus tag: SACOL1720 ]
  • pan locus tag?: SAUPAN004288000
  • symbol: engB
  • pan gene symbol?: engB
  • synonym:
  • product: GTP-binding protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL_RS08785 [old locus tag: SACOL1720 ]
  • symbol: engB
  • product: GTP-binding protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1751090..1751680
  • length: 591
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NC_002951 (1751090..1751680) NCBI
  • BioCyc: SACOL_RS08785 BioCyc
  • MicrobesOnline: see SACOL1720

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGAAAGTTAATCCTAATAATATAGAATTAATCATTAGTGCAGTAAAAGAAGAACAATAT
    CCAGAAACAGAATTGTCTGAAGTTGCACTGAGCGGTCGATCTAATGTAGGTAAGTCTACA
    TTTATCAATAGTATGATTGGCAGAAAAAATATGGCACGTACATCACAGCAACCCGGCAAA
    ACGCAAACGTTAAATTTTTATAATATAGATGAACAACTTATTTTTGTGGATGTTCCAGGA
    TATGGATATGCTAAAGTAAGTAAAACACAACGTGAAAAATTTGGGAAAATGATTGAGGAA
    TATATAACTAAGAGAGAGAATTTGCAATTAGTTATTCAATTAGTTGATTTAAGACATGAT
    CCAACACAAGATGATATCTTAATGTACAATTATTTGAAACATTTTGATATTCCTACTTTA
    GTTATATGCACTAAAGAAGACAAAATTCCAAAAGGTAAGGTTCAAAAGCATATTAAAAAT
    ATTAAGACACAATTAGATATGGACCCAGACGATACAATTGTAAGTTATTCATCAATTCAA
    AATAATAAACAACAACAAATATGGAATTTAATTGAACCGTATATTTCATAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    591

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL_RS08785 [old locus tag: SACOL1720 ]
  • symbol: EngB
  • description: GTP-binding protein
  • length: 196
  • theoretical pI: 7.58416
  • theoretical MW: 22684.8
  • GRAVY: -0.585204

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein synthesis Other ribosome biogenesis GTP-binding protein YsxC (TIGR03598; HMM-score: 225.8)
    and 13 more
    Genetic information processing Protein synthesis Other GTP-binding protein Era (TIGR00436; HMM-score: 63.9)
    Genetic information processing Protein synthesis Other ribosome-associated GTPase EngA (TIGR03594; HMM-score: 60.6)
    Genetic information processing Protein synthesis Other ribosome biogenesis GTP-binding protein YlqF (TIGR03596; HMM-score: 50.3)
    Genetic information processing Protein synthesis Other ribosome biogenesis GTPase YqeH (TIGR03597; HMM-score: 41.3)
    Unknown function General small GTP-binding protein domain (TIGR00231; HMM-score: 37)
    Genetic information processing Protein fate Protein modification and repair [FeFe] hydrogenase H-cluster maturation GTPase HydF (TIGR03918; HMM-score: 35.1)
    Genetic information processing Protein synthesis tRNA and rRNA base modification tRNA modification GTPase TrmE (TIGR00450; EC 3.6.-.-; HMM-score: 33.1)
    Genetic information processing Protein synthesis Other Obg family GTPase CgtA (TIGR02729; HMM-score: 28)
    Metabolism Transport and binding proteins Cations and iron carrying compounds ferrous iron transport protein B (TIGR00437; HMM-score: 23.8)
    Unknown function General GTP-binding protein HflX (TIGR03156; HMM-score: 19.7)
    Genetic information processing Protein synthesis Translation factors ribosome small subunit-dependent GTPase A (TIGR00157; EC 3.6.-.-; HMM-score: 15.5)
    Metabolism Transport and binding proteins Amino acids, peptides and amines chloroplast protein import component Toc86/159, G and M domains (TIGR00993; HMM-score: 14)
    Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 13.9)
  • TheSEED: see SACOL1720
  • PFAM:
    P-loop_NTPase (CL0023) MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 75.1)
    and 12 more
    FeoB_N; Ferrous iron transport protein B (PF02421; HMM-score: 38.1)
    Dynamin_N; Dynamin family (PF00350; HMM-score: 32.2)
    RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 26.3)
    GTP_EFTU; Elongation factor Tu GTP binding domain (PF00009; HMM-score: 21.1)
    AIG1; AIG1 family (PF04548; HMM-score: 20.8)
    DUF5906; Family of unknown function (DUF5906) (PF19263; HMM-score: 16.5)
    Septin; Septin (PF00735; HMM-score: 16.3)
    IIGP; Interferon-inducible GTPase (IIGP) (PF05049; HMM-score: 15)
    no clan defined WipA_N; WipA, alpha-helical hairpin (PF21662; HMM-score: 14.9)
    Phosphatase (CL0031) Rhodanese; Rhodanese-like domain (PF00581; HMM-score: 13.7)
    P-loop_NTPase (CL0023) cobW; CobW/HypB/UreG, nucleotide-binding domain (PF02492; HMM-score: 12.9)
    AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 12.7)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors: Mg2+
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9958
    • Cytoplasmic Membrane Score: 0.0016
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0026
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.020891
    • TAT(Tat/SPI): 0.005097
    • LIPO(Sec/SPII): 0.002423
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKVNPNNIELIISAVKEEQYPETELSEVALSGRSNVGKSTFINSMIGRKNMARTSQQPGKTQTLNFYNIDEQLIFVDVPGYGYAKVSKTQREKFGKMIEEYITKRENLQLVIQLVDLRHDPTQDDILMYNYLKHFDIPTLVICTKEDKIPKGKVQKHIKNIKTQLDMDPDDTIVSYSSIQNNKQQQIWNLIEPYIS

Experimental data[edit | edit source]

  • experimentally validated: see SACOL1720
  • protein localization: see SACOL1720
  • quantitative data / protein copy number per cell: see SACOL1720
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]