Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_1620 [new locus tag: SAUSA300_RS08830 ]
- pan locus tag?: SAUPAN004288000
- symbol: engB
- pan gene symbol?: engB
- synonym: yihA
- product: ribosome biogenesis GTP-binding protein YsxC
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_1620 [new locus tag: SAUSA300_RS08830 ]
- symbol: engB
- product: ribosome biogenesis GTP-binding protein YsxC
- replicon: chromosome
- strand: -
- coordinates: 1773927..1774517
- length: 591
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3914929 NCBI
- RefSeq: YP_494315 NCBI
- BioCyc: see SAUSA300_RS08830
- MicrobesOnline: 1293135 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541ATGAAAGTTAATCCTAATAATATAGAATTAATCATTAGTGCAGTAAAAGAAGAACAATAT
CCAGAAACAGAATTGTCTGAAGTTGCACTGAGCGGTCGATCTAATGTAGGTAAGTCTACA
TTTATCAATAGTATGATTGGCAGAAAAAATATGGCACGTACATCACAGCAACCCGGCAAA
ACGCAAACGTTAAATTTTTATAATATAGATGAACAACTTATTTTTGTGGATGTTCCAGGG
TATGGATATGCTAAAGTAAGTAAAACACAACGTGAAAAATTTGGGAAAATGATTGAGGAA
TATATAACTAAGAGAGAGAATTTGCAATTAGTTATTCAATTAGTTGATTTAAGACATGAT
CCAACACAAGATGATATCTTAATGTACAATTATTTGAAACATTTTGATATTCCTACTTTA
GTTATATGCACTAAAGAAGACAAAATTCCAAAAGGTAAGGTTCAAAAGCATATTAAAAAT
ATTAAGACACAATTAGATATGGACCCAGACGATACAATTGTAAGTTATTCATCAATTCAA
AATAATAAACAACAACAAATATGGAATTTAATTGAACCGTATATTTCATAG60
120
180
240
300
360
420
480
540
591
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_1620 [new locus tag: SAUSA300_RS08830 ]
- symbol: EngB
- description: ribosome biogenesis GTP-binding protein YsxC
- length: 196
- theoretical pI: 7.58416
- theoretical MW: 22684.8
- GRAVY: -0.585204
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Other ribosome biogenesis GTP-binding protein YsxC (TIGR03598; HMM-score: 225.8)and 13 moreProtein synthesis Other GTP-binding protein Era (TIGR00436; HMM-score: 63.9)Protein synthesis Other ribosome-associated GTPase EngA (TIGR03594; HMM-score: 60.6)Protein synthesis Other ribosome biogenesis GTP-binding protein YlqF (TIGR03596; HMM-score: 50.3)Protein synthesis Other ribosome biogenesis GTPase YqeH (TIGR03597; HMM-score: 41.3)Unknown function General small GTP-binding protein domain (TIGR00231; HMM-score: 37)Protein fate Protein modification and repair [FeFe] hydrogenase H-cluster maturation GTPase HydF (TIGR03918; HMM-score: 35.1)Protein synthesis tRNA and rRNA base modification tRNA modification GTPase TrmE (TIGR00450; EC 3.6.-.-; HMM-score: 33.1)Protein synthesis Other Obg family GTPase CgtA (TIGR02729; HMM-score: 28)Transport and binding proteins Cations and iron carrying compounds ferrous iron transport protein B (TIGR00437; HMM-score: 23.8)Unknown function General GTP-binding protein HflX (TIGR03156; HMM-score: 19.7)Protein synthesis Translation factors ribosome small subunit-dependent GTPase A (TIGR00157; EC 3.6.-.-; HMM-score: 15.5)Transport and binding proteins Amino acids, peptides and amines chloroplast protein import component Toc86/159, G and M domains (TIGR00993; HMM-score: 14)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 13.9)
- TheSEED :
- GTP-binding protein EngB
- PFAM: P-loop_NTPase (CL0023) MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 75.1)and 12 moreFeoB_N; Ferrous iron transport protein B (PF02421; HMM-score: 38.1)Dynamin_N; Dynamin family (PF00350; HMM-score: 32.2)RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 26.3)GTP_EFTU; Elongation factor Tu GTP binding domain (PF00009; HMM-score: 21.1)AIG1; AIG1 family (PF04548; HMM-score: 20.8)DUF5906; Family of unknown function (DUF5906) (PF19263; HMM-score: 16.5)Septin; Septin (PF00735; HMM-score: 16.3)IIGP; Interferon-inducible GTPase (IIGP) (PF05049; HMM-score: 15)no clan defined WipA_N; WipA, alpha-helical hairpin (PF21662; HMM-score: 14.9)Phosphatase (CL0031) Rhodanese; Rhodanese-like domain (PF00581; HMM-score: 13.7)P-loop_NTPase (CL0023) cobW; CobW/HypB/UreG, nucleotide-binding domain (PF02492; HMM-score: 12.9)AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 12.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors: Mg2+
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9958
- Cytoplasmic Membrane Score: 0.0016
- Cell wall & surface Score: 0
- Extracellular Score: 0.0026
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.020891
- TAT(Tat/SPI): 0.005097
- LIPO(Sec/SPII): 0.002423
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKVNPNNIELIISAVKEEQYPETELSEVALSGRSNVGKSTFINSMIGRKNMARTSQQPGKTQTLNFYNIDEQLIFVDVPGYGYAKVSKTQREKFGKMIEEYITKRENLQLVIQLVDLRHDPTQDDILMYNYLKHFDIPTLVICTKEDKIPKGKVQKHIKNIKTQLDMDPDDTIVSYSSIQNNKQQQIWNLIEPYIS
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]