Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL_RS08405 [old locus tag: SACOL1648 ]
- pan locus tag?: SAUPAN004178000
- symbol: SACOL_RS08405
- pan gene symbol?: rsfS
- synonym:
- product: ribosome silencing factor RsfS
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL_RS08405 [old locus tag: SACOL1648 ]
- symbol: SACOL_RS08405
- product: ribosome silencing factor RsfS
- replicon: chromosome
- strand: -
- coordinates: 1679597..1679950
- length: 354
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_002951 (1679597..1679950) NCBI
- BioCyc: SACOL_RS08405 BioCyc
- MicrobesOnline: see SACOL1648
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGAATTCACAAGAATTATTAGCAATTGCTGTGGATGCAATTGACAATAAAAAAGGCGAA
GATACGATTTCTTTAGAAATGAAAGGTATCAGCGATATGACAGATTATTTTGTTGTAACG
CACGGAAATAATGAACGACAAGTTCAAGCGATTGCTAGAGCGGTGAAAGAAGTAGCCAAT
GAACAAAATATAGAAGTAAAACGTATGGAAGGATACAATGAAGCGCGTTGGATATTAATT
GACTTAGCTGATGTTGTGGTACATGTTTTCCATAAAGACGAAAGAAATTATTATAATATT
GAAAAGTTATATCAAGATGCACCATTAGAATCATATAGTCAGGTTGCGTATTAA60
120
180
240
300
354
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL_RS08405 [old locus tag: SACOL1648 ]
- symbol: SACOL_RS08405
- description: ribosome silencing factor RsfS
- length: 117
- theoretical pI: 4.42783
- theoretical MW: 13482
- GRAVY: -0.463248
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Translation factors ribosome silencing factor (TIGR00090; HMM-score: 112.2)and 1 more[FeFe] hydrogenase, group A (TIGR02512; EC 1.12.-.-; HMM-score: 12.9)
- TheSEED: see SACOL1648
- PFAM: NTP_transf (CL0260) RsfS; Ribosomal silencing factor during starvation (PF02410; HMM-score: 108.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9959
- Cytoplasmic Membrane Score: 0.0009
- Cell wall & surface Score: 0
- Extracellular Score: 0.0032
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005488
- TAT(Tat/SPI): 0.000356
- LIPO(Sec/SPII): 0.001039
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MNSQELLAIAVDAIDNKKGEDTISLEMKGISDMTDYFVVTHGNNERQVQAIARAVKEVANEQNIEVKRMEGYNEARWILIDLADVVVHVFHKDERNYYNIEKLYQDAPLESYSQVAY
⊟Experimental data[edit | edit source]
- experimentally validated: see SACOL1648
- protein localization: see SACOL1648
- quantitative data / protein copy number per cell: see SACOL1648
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]