Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL_RS08200 [old locus tag: SACOL1608 ]
- pan locus tag?: SAUPAN004132000
- symbol: SACOL_RS08200
- pan gene symbol?: rpmG
- synonym:
- product: 50S ribosomal protein L33
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL_RS08200 [old locus tag: SACOL1608 ]
- symbol: SACOL_RS08200
- product: 50S ribosomal protein L33
- replicon: chromosome
- strand: -
- coordinates: 1638642..1638791
- length: 150
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_002951 (1638642..1638791) NCBI
- BioCyc: SACOL_RS08200 BioCyc
- MicrobesOnline: see SACOL1608
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGCGCGTAAACGTAACTTTAGCTTGTACGGAATGTGGTGACAGAAACTACATTACAACT
AAGAACAAAAGAAATAATCCAGAACGTGTTGAAATGAAGAAATTCTGTTCACGTGAAAAC
AAACAAACTTTACACCGTGAAACAAAATAA60
120
150
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL_RS08200 [old locus tag: SACOL1608 ]
- symbol: SACOL_RS08200
- description: 50S ribosomal protein L33
- length: 49
- theoretical pI: 10.2922
- theoretical MW: 5872.72
- GRAVY: -1.36327
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein bL33 (TIGR01023; HMM-score: 73.5)
- TheSEED: see SACOL1608
- PFAM: Zn_Beta_Ribbon (CL0167) Ribosomal_L33; Ribosomal protein L33 (PF00471; HMM-score: 83.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 10
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.6495
- Cytoplasmic Membrane Score: 0.0001
- Cell wall & surface Score: 0.0003
- Extracellular Score: 0.3502
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.093897
- TAT(Tat/SPI): 0.004774
- LIPO(Sec/SPII): 0.056419
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MRVNVTLACTECGDRNYITTKNKRNNPERVEMKKFCSRENKQTLHRETK
⊟Experimental data[edit | edit source]
- experimentally validated: see SACOL1608
- protein localization:
- quantitative data / protein copy number per cell: see SACOL1608
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]