From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS05440 [old locus tag: SACOL1067 ]
  • pan locus tag?: SAUPAN003267000
  • symbol: SACOL_RS05440
  • pan gene symbol?: qoxD
  • synonym:
  • product: quinol oxidase subunit 4

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SACOL_RS05440 [old locus tag: SACOL1067 ]
  • symbol: SACOL_RS05440
  • product: quinol oxidase subunit 4
  • replicon: chromosome
  • strand: -
  • coordinates: 1076196..1076486
  • length: 291
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

  • Location: NC_002951 (1076196..1076486) NCBI
  • BioCyc: SACOL_RS05440 BioCyc
  • MicrobesOnline: see SACOL1067

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGAGTACAATAATGAAACATACTGTAGGATTTATCGCATCTATCGTATTAACGCTTTTA
    GCAGTTTACGTAACACTATACACGTCATTAACATTCCACGCGAAGTTGACAATTATCTTT
    GGCTTTGCATTCGTCCAAGCAGGACTTCAATTATTAATGTTCATGCATTTAACTGAAGGT
    AAAGATGGACGTTTACAAACATTCAAAGTTATCTTTGCTCTTGTAATTACACTTTGTTTC
    GTTGTCGGAACATATTGGGTTATGCAAGGCGGTCACTCTTCACACTTATAA
    60
    120
    180
    240
    291

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SACOL_RS05440 [old locus tag: SACOL1067 ]
  • symbol: SACOL_RS05440
  • description: quinol oxidase subunit 4
  • length: 96
  • theoretical pI: 9.69391
  • theoretical MW: 10686.8
  • GRAVY: 1.01979

⊟Function[edit | edit source]

  • reaction:
    EC 1.9.3.-?  ExPASy
    EC 1.10.3.-?  ExPASy
    2 a quinol + O2 = 2 a quinone + 2 H2O?
  • TIGRFAM:
    Metabolism Energy metabolism Electron transport cytochrome aa3 quinol oxidase, subunit IV (TIGR02901; EC 1.10.3.-; HMM-score: 104.3)
    and 3 more
    Metabolism Energy metabolism Electron transport cytochrome o ubiquinol oxidase subunit IV (TIGR02847; EC 1.10.3.-; HMM-score: 55.5)
    Metabolism Energy metabolism Electron transport caa(3)-type oxidase, subunit IV (TIGR02229; HMM-score: 16.8)
    Metabolism Energy metabolism Electron transport cytochrome c oxidase, subunit IVB (TIGR02908; EC 1.9.3.1; HMM-score: 15.5)
  • TheSEED: see SACOL1067
  • PFAM:
    no clan defined COX4_pro; Prokaryotic Cytochrome C oxidase subunit IV (PF03626; HMM-score: 45.5)
    and 2 more
    Yip1 (CL0112) DUF1700; Protein of unknown function (DUF1700) (PF08006; HMM-score: 9.9)
    no clan defined PHO4; Phosphate transporter family (PF01384; HMM-score: 7.9)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 3
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.005989
    • TAT(Tat/SPI): 0.00029
    • LIPO(Sec/SPII): 0.002534
  • predicted transmembrane helices (TMHMM): 3

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MSTIMKHTVGFIASIVLTLLAVYVTLYTSLTFHAKLTIIFGFAFVQAGLQLLMFMHLTEGKDGRLQTFKVIFALVITLCFVVGTYWVMQGGHSSHL

⊟Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization: see SACOL1067
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=SACOL_RS05440&oldid=99305"