Jump to navigation
		Jump to search
		
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL_RS04870 [old locus tag: SACOL0950 ]
- pan locus tag?: SAUPAN003048000
- symbol: SACOL_RS04870
- pan gene symbol?: mnhF1
- synonym:
- product: Na+/H+ antiporter subunit F
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL_RS04870 [old locus tag: SACOL0950 ]
- symbol: SACOL_RS04870
- product: Na+/H+ antiporter subunit F
- replicon: chromosome
- strand: -
- coordinates: 952138..952431
- length: 294
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
 61
 121
 181
 241ATGAATCATAATGTTATTATCGTTATTGCATTAATCATAGTTGTCATTTCTATGTTAGCT
 ATGCTCATTCGCGTTGTGCTAGGCCCATCACTTGCCGATCGTGTTGTCGCATTAGATGCG
 ATTGGTCTTCAATTAATGGCAGTTATAGCATTATTCAGTATTTTATTAAATATTAAATAC
 ATGATTGTCGTTATTATGATGATTGGTATATTAGCTTTTTTAGGTACTGCAGTATTCTCT
 AAATTTATGGACAAAGGTAAGGTGATTGAACATGATCAAAATCATACTGATTAG60
 120
 180
 240
 294
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL_RS04870 [old locus tag: SACOL0950 ]
- symbol: SACOL_RS04870
- description: Na+/H+ antiporter subunit F
- length: 97
- theoretical pI: 7.7971
- theoretical MW: 10616.1
- GRAVY: 1.3701
⊟Function[edit | edit source]
- TIGRFAM: Mobile and extrachromosomal element functions Plasmid functions entry exclusion protein TrbK (TIGR04361; HMM-score: 9.9)and 1 moreTIGR03943 family protein (TIGR03943; HMM-score: 6.5)
- TheSEED: see SACOL0950
- PFAM: no clan defined MrpF_PhaF; Multiple resistance and pH regulation protein F (MrpF / PhaF) (PF04066; HMM-score: 50.1)and 1 moreDUF4834; Domain of unknown function (DUF4834) (PF16118; HMM-score: 11.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 3
 
- DeepLocPro: Cytoplasmic Membrane- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9995
- Cell wall & surface Score: 0
- Extracellular Score: 0.0005
 
- LocateP:
- SignalP: no predicted signal peptide- SP(Sec/SPI): 0.033588
- TAT(Tat/SPI): 0.000316
- LIPO(Sec/SPII): 0.021791
 
- predicted transmembrane helices (TMHMM): 3
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MNHNVIIVIALIIVVISMLAMLIRVVLGPSLADRVVALDAIGLQLMAVIALFSILLNIKYMIVVIMMIGILAFLGTAVFSKFMDKGKVIEHDQNHTD
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization: see SACOL0950
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- data available for JSNZ
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]