From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS01680 [old locus tag: SACOL0334 ]
  • pan locus tag?: SAUPAN001434000
  • symbol: SACOL_RS01680
  • pan gene symbol?:
  • synonym:
  • product: DUF1270 domain-containing protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL_RS01680 [old locus tag: SACOL0334 ]
  • symbol: SACOL_RS01680
  • product: DUF1270 domain-containing protein
  • replicon: chromosome
  • strand: +
  • coordinates: 361971..362132
  • length: 162
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NC_002951 (361971..362132) NCBI
  • BioCyc: SACOL_RS01680 BioCyc
  • MicrobesOnline: see SACOL0334

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    ATGAGCGACACATATAAAAGCTACCTAGTAGCAGTACTATGCTTCACAGTCTTAGCAATT
    GTACTTATGCCGTTTCTATACTTCACTACAGCATGGTCAATTGCGGGATTCGCAAGTATC
    GCAACATTCATATTTTATAAAGAATACTTTTATGAAGAATAA
    60
    120
    162

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL_RS01680 [old locus tag: SACOL0334 ]
  • symbol: SACOL_RS01680
  • description: DUF1270 domain-containing protein
  • length: 53
  • theoretical pI: 4.1475
  • theoretical MW: 6187.23
  • GRAVY: 0.967925

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: see SACOL0334
  • PFAM:
    no clan defined DUF1270; Protein of unknown function (DUF1270) (PF06900; HMM-score: 131.9)
    and 2 more
    EcsB; Bacterial ABC transporter protein EcsB (PF05975; HMM-score: 14.7)
    PH (CL0266) DUF2244; Integral membrane protein (DUF2244) (PF10003; HMM-score: 13.3)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0001
    • Cytoplasmic Membrane Score: 0.9507
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.0491
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.027745
    • TAT(Tat/SPI): 0.007712
    • LIPO(Sec/SPII): 0.051244
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MSDTYKSYLVAVLCFTVLAIVLMPFLYFTTAWSIAGFASIATFIFYKEYFYEE

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]