Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL2453 [new locus tag: SACOL_RS12875 ]
- pan locus tag?: SAUPAN006000000
- symbol: SACOL2453
- pan gene symbol?: opuCA
- synonym:
- product: amino acid ABC transporter ATP-binding protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL2453 [new locus tag: SACOL_RS12875 ]
- symbol: SACOL2453
- product: amino acid ABC transporter ATP-binding protein
- replicon: chromosome
- strand: -
- coordinates: 2512342..2513568
- length: 1227
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3237257 NCBI
- RefSeq: YP_187252 NCBI
- BioCyc: see SACOL_RS12875
- MicrobesOnline: 913929 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661
721
781
841
901
961
1021
1081
1141
1201ATGTTAAGTATTAAGCATTTAACGAAAATTTATTCTGGTAATAAAAAGGCAGTAGATGAC
ATCTCTTTAGATATTCAATCTGGGGAATTTATCGCATTTATTGGAACCAGTGGAAGTGGC
AAAACGACTGCTTTAAGAATGATAAACCGTATGATTGAAGCGACAGAAGGACAAATTGAA
ATTGATGGTAAAGATGTTCGGAGTATGAATCCTGTCGAATTGCGTAGAAATATTGGCTAT
GTTATTCAACAAATTGGCTTAATGCCTCATATGACGATTAAAGAGAATATTGTGTTGGTA
CCCAAATTGTTGAAATGGACTAAAGAGGAAAAGGATAAACGTGCAAAGGAATTAATTAAA
CTTGTGGATTTACCGGAGTCATTTTTAGAGCGTTATCCAGCAGAACTATCAGGTGGGCAA
CAACAACGTATCGGTGTTGTAAGAGCACTTGCGGCCGAACAAGATATTATTTTAATGGAT
GAACCTTTTGGTGCATTGGATCCTATTACGAGAGATACGTTACAAGATTTAGTTAAAACG
TTACAACGAAAATTAGGCAAGACGTTTATCTTTGTAACACATGATATGGATGAAGCGATT
AAATTAGCAGACAAAATTTGTATTATGTCAGAAGGTAAGGTGGTGCAATTTGATACGCCA
GACAATATTTTAAGACATCCCGCAAATGATTTTGTACGTGATTTTATAGGACAAAATAGA
CTGATTCAAGACCGTCCCAATGACAAGACTGTAGAAGGTGTAATGATTAAACCAATCACG
ATACAAGCAGAAGCAACACTGAATGACGCCGTTCATATTATGAGACAAAAACGTGTTGAT
ACTATTTTTGTAGTAGATAGTAATAACCATTTACTAGGTTTCTTAGACATTGAAGATATA
AATCAGGGTATACGTGGACACAAAAGTTTACGAGACACCATGCAACAACATATTTATACC
GTTCAAATTGATTCTAAATTACAAGATTCTGTACGTACGATTTTAAAAAGAAACGTTAGG
AATGTACCTGTCGTAGATGATCAACAGCGTTTAGTAGGACTGATTACGCGTGCCAATGTT
GTTGATATTGTATATGACACGATTTGGGGCGATAGTGAGGATACAGTGCAAACAGAACAT
GTGGGGGAAGACACTGCGTCCTCAAAAGTGCATGAGCAACACACTACTAATGTCAAAGTA
CGTGACATAGGAGATGATAAATCATGA60
120
180
240
300
360
420
480
540
600
660
720
780
840
900
960
1020
1080
1140
1200
1227
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL2453 [new locus tag: SACOL_RS12875 ]
- symbol: SACOL2453
- description: amino acid ABC transporter ATP-binding protein
- length: 408
- theoretical pI: 6.15286
- theoretical MW: 46173.6
- GRAVY: -0.347549
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 457.3)and 77 moreTransport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 246.6)Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 244.9)Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 232)Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 224.7)2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 202)Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 192)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 190.5)Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 177.3)Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 175.7)D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 170.5)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 166)Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 159.2)Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 155.2)Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 155.2)ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 154.9)Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 153.2)Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 153.2)Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 152)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 148.7)ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 147.8)Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 147.8)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 147.8)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 146.5)Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 146.5)Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 146)Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 144.9)Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 139.5)thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 136.7)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 135.7)Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 133.5)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 131.4)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 126.3)gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 126.1)ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 123.9)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 122.9)Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 122.9)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 121)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 121)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 119.2)lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 114.1)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 114)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 114)thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 112.7)Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 108.5)Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 108.5)Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 108.5)proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 108.2)Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 106.1)Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 106.1)Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 105.4)Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 102.2)phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 99.6)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 99.5)Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 97)Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 95.4)Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 94)Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 91.2)Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 90.6)Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 90.6)Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 84.2)Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 80.9)Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 76.2)Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 62.9)Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 61.7)Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 58.5)Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 58.5)ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 54.6)Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 47.4)Purines, pyrimidines, nucleosides, and nucleotides Purine ribonucleotide biosynthesis inosine-5'-monophosphate dehydrogenase (TIGR01302; EC 1.1.1.205; HMM-score: 45.4)DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 41.6)Energy metabolism Sugars sugar isomerase, KpsF/GutQ family (TIGR00393; HMM-score: 36.7)Transport and binding proteins Cations and iron carrying compounds magnesium transporter (TIGR00400; HMM-score: 35.5)Unknown function General IMP dehydrogenase family protein (TIGR01303; HMM-score: 25.5)Amino acid biosynthesis Serine family cystathionine beta-synthase (TIGR01137; EC 4.2.1.22; HMM-score: 24.3)Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 20.3)Purines, pyrimidines, nucleosides, and nucleotides Nucleotide and nucleoside interconversions dTMP kinase (TIGR00041; EC 2.7.4.9; HMM-score: 13.4)Central intermediary metabolism Sulfur metabolism adenylyl-sulfate kinase (TIGR00455; EC 2.7.1.25; HMM-score: 13)
- TheSEED :
- Osmotically activated L-carnitine/choline ABC transporter, ATP-binding protein OpuCA
- PFAM: P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 123.3)and 16 moreno clan defined CBS; CBS domain (PF00571; HMM-score: 75.3)P-loop_NTPase (CL0023) AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 25.3)AAA_22; AAA domain (PF13401; HMM-score: 20.9)AAA_15; AAA ATPase domain (PF13175; HMM-score: 20.8)AAA_30; AAA domain (PF13604; HMM-score: 17.5)AAA_18; AAA domain (PF13238; HMM-score: 16.6)Zeta_toxin; Zeta toxin (PF06414; HMM-score: 16.4)nSTAND3; Novel STAND NTPase 3 (PF20720; HMM-score: 16.3)AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 15.7)ABC_ATPase; P-loop domain (PF09818; HMM-score: 15.1)AAA_28; AAA domain (PF13521; HMM-score: 14.4)AAA_19; AAA domain (PF13245; HMM-score: 13.4)AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 13.2)ATPase_2; ATPase domain predominantly from Archaea (PF01637; HMM-score: 11.5)NB-ARC; NB-ARC domain (PF00931; HMM-score: 10.9)Cache (CL0165) Cache_WalK; WalK sensor protein kinase Chache domain (PF23846; HMM-score: 10.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 1.05
- Cytoplasmic Membrane Score: 8.78
- Cellwall Score: 0.08
- Extracellular Score: 0.09
- Internal Helices: 0
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0521
- Cytoplasmic Membrane Score: 0.9077
- Cell wall & surface Score: 0.0008
- Extracellular Score: 0.0395
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.004967
- TAT(Tat/SPI): 0.000629
- LIPO(Sec/SPII): 0.000633
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MLSIKHLTKIYSGNKKAVDDISLDIQSGEFIAFIGTSGSGKTTALRMINRMIEATEGQIEIDGKDVRSMNPVELRRNIGYVIQQIGLMPHMTIKENIVLVPKLLKWTKEEKDKRAKELIKLVDLPESFLERYPAELSGGQQQRIGVVRALAAEQDIILMDEPFGALDPITRDTLQDLVKTLQRKLGKTFIFVTHDMDEAIKLADKICIMSEGKVVQFDTPDNILRHPANDFVRDFIGQNRLIQDRPNDKTVEGVMIKPITIQAEATLNDAVHIMRQKRVDTIFVVDSNNHLLGFLDIEDINQGIRGHKSLRDTMQQHIYTVQIDSKLQDSVRTILKRNVRNVPVVDDQQRLVGLITRANVVDIVYDTIWGDSEDTVQTEHVGEDTASSKVHEQHTTNVKVRDIGDDKS
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: CodY (repression) regulon
CodY (TF) important in Amino acid metabolism; RegPrecise
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
J Proteome Res: 2010, 9(3);1579-90
[PubMed:20108986] [WorldCat.org] [DOI] (I p) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e)