From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2434 [new locus tag: SACOL_RS12775 ]
  • pan locus tag?: SAUPAN005978000
  • symbol: SACOL2434
  • pan gene symbol?:
  • synonym: gtxA
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL2434 [new locus tag: SACOL_RS12775 ]
  • symbol: SACOL2434
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2492187..2492573
  • length: 387
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGAAACTAACACAAACGCATGCTGAAATTTTAAAATTTATCATTGTTGGCGGCATTAAT
    ACGTTAAATTATTATGTTGTCTATTTATTGCTGTTAAAATTATTACACATTGAATATATG
    ATTAGTCATATTACCGGATTTCTAGTCGCTTTTGTGATTTCATATTATTTGAATTGTTAT
    TTTGTTTACAGGGTAAAACCTACTTGGAGAAAATTCATTAGTTTTCCAATTACGCAGATT
    GTCAACGTAAGCTTACAAACAGTTTTATTATATGTATTTGTATCCTGGCTAAATTTGCCA
    GCAGAAATTGCACCATTTGCTGGTTTAATTATTACGATACCCATCACATTTATATTATCT
    AAATGGATTTTAAAAGATAGCAATTAA
    60
    120
    180
    240
    300
    360
    387

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL2434 [new locus tag: SACOL_RS12775 ]
  • symbol: SACOL2434
  • description: hypothetical protein
  • length: 128
  • theoretical pI: 9.70953
  • theoretical MW: 14892.9
  • GRAVY: 0.9125

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • Putative sugar translocase in surface polysaccharides biosynthesis
  • PFAM:
    no clan defined GtrA_DPMS_TM; GtrA/DPMS, transmembrane domain (PF04138; HMM-score: 94.6)
    and 3 more
    CdaA_N; CdaA N-terminal transmembrane domain (PF19293; HMM-score: 13.3)
    DUF4229; Protein of unknown function (DUF4229) (PF14012; HMM-score: 8.5)
    Syndecan; Syndecan domain (PF01034; HMM-score: 8)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 4
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.9999
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0001
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.000708
    • TAT(Tat/SPI): 0.000085
    • LIPO(Sec/SPII): 0.012672
  • predicted transmembrane helices (TMHMM): 4

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKLTQTHAEILKFIIVGGINTLNYYVVYLLLLKLLHIEYMISHITGFLVAFVISYYLNCYFVYRVKPTWRKFISFPITQIVNVSLQTVLLYVFVSWLNLPAEIAPFAGLIITIPITFILSKWILKDSN

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization: Integral membrane [1]
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator: SigB* (activation) regulon
    SigB*(sigma factor)controlling a large regulon involved in stress/starvation response and adaptation;  [2]   other strains

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
    Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
    J Bacteriol: 2004, 186(13);4085-99
    [PubMed:15205410] [WorldCat.org] [DOI] (P p)

Relevant publications[edit | edit source]