Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL2434 [new locus tag: SACOL_RS12775 ]
- pan locus tag?: SAUPAN005978000
- symbol: SACOL2434
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL2434 [new locus tag: SACOL_RS12775 ]
- symbol: SACOL2434
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2492187..2492573
- length: 387
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3238053 NCBI
- RefSeq: YP_187235 NCBI
- BioCyc: see SACOL_RS12775
- MicrobesOnline: 913912 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGAAACTAACACAAACGCATGCTGAAATTTTAAAATTTATCATTGTTGGCGGCATTAAT
ACGTTAAATTATTATGTTGTCTATTTATTGCTGTTAAAATTATTACACATTGAATATATG
ATTAGTCATATTACCGGATTTCTAGTCGCTTTTGTGATTTCATATTATTTGAATTGTTAT
TTTGTTTACAGGGTAAAACCTACTTGGAGAAAATTCATTAGTTTTCCAATTACGCAGATT
GTCAACGTAAGCTTACAAACAGTTTTATTATATGTATTTGTATCCTGGCTAAATTTGCCA
GCAGAAATTGCACCATTTGCTGGTTTAATTATTACGATACCCATCACATTTATATTATCT
AAATGGATTTTAAAAGATAGCAATTAA60
120
180
240
300
360
387
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL2434 [new locus tag: SACOL_RS12775 ]
- symbol: SACOL2434
- description: hypothetical protein
- length: 128
- theoretical pI: 9.70953
- theoretical MW: 14892.9
- GRAVY: 0.9125
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- Putative sugar translocase in surface polysaccharides biosynthesis
- PFAM: no clan defined GtrA_DPMS_TM; GtrA/DPMS, transmembrane domain (PF04138; HMM-score: 94.6)and 3 moreCdaA_N; CdaA N-terminal transmembrane domain (PF19293; HMM-score: 13.3)DUF4229; Protein of unknown function (DUF4229) (PF14012; HMM-score: 8.5)Syndecan; Syndecan domain (PF01034; HMM-score: 8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 4
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9999
- Cell wall & surface Score: 0
- Extracellular Score: 0.0001
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.000708
- TAT(Tat/SPI): 0.000085
- LIPO(Sec/SPII): 0.012672
- predicted transmembrane helices (TMHMM): 4
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKLTQTHAEILKFIIVGGINTLNYYVVYLLLLKLLHIEYMISHITGFLVAFVISYYLNCYFVYRVKPTWRKFISFPITQIVNVSLQTVLLYVFVSWLNLPAEIAPFAGLIITIPITFILSKWILKDSN
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization: Integral membrane [1]
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
J Bacteriol: 2004, 186(13);4085-99
[PubMed:15205410] [WorldCat.org] [DOI] (P p)