From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2258 [new locus tag: SACOL_RS11870 ]
  • pan locus tag?: SAUPAN005724000
  • symbol: sarV
  • pan gene symbol?: sarV
  • synonym:
  • product: hypothetical protein

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SACOL2258 [new locus tag: SACOL_RS11870 ]
  • symbol: sarV
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2324350..2324700
  • length: 351
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGAGTAATAAAGTTCAACGTTTTATAGAAGCAGAAAGGGAGTTAAGTCAGTTAAAGCAC
    TGGTTAAAAACAACACATAAGATTTCAATTGAAGAATTTGTAGTCCTTTTTAAAGTGTAT
    GAAGCTGAAAAGATTAGCGGTAAAGAATTGAGGGATACATTACATTTTGAAATGCTATGG
    GATACAAGTAAAATCGATGTGATTATCCGTAAAATCTATAAAAAAGAGCTTATTTCTAAA
    TTGCGTTCTGAAACGGATGAAAGACAAGTATTCTATTTCTATAGTACTTCTCAAAAGAAA
    TTGTTAGATAAAATTACTAAAGAAATAGAAGTGTTAAGCGTTACAAACTAA
    60
    120
    180
    240
    300
    351


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SACOL2258 [new locus tag: SACOL_RS11870 ]
  • symbol: SarV
  • description: hypothetical protein
  • length: 116
  • theoretical pI: 9.64293
  • theoretical MW: 13986.2
  • GRAVY: -0.47069

⊟Function[edit | edit source]

  • TIGRFAM:
    Signal transduction Regulatory functions DNA interactions staphylococcal accessory regulator family (TIGR01889; HMM-score: 86.5)
    and 4 more
    Metabolism Transport and binding proteins Cations and iron carrying compounds copper transport repressor, CopY/TcrY family (TIGR02698; HMM-score: 21.5)
    Signal transduction Regulatory functions DNA interactions copper transport repressor, CopY/TcrY family (TIGR02698; HMM-score: 21.5)
    homoprotocatechuate degradation operon regulator, HpaR (TIGR02337; HMM-score: 19.4)
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides 2'-Deoxyribonucleotide metabolism nrdI protein (TIGR00333; HMM-score: 13.8)
  • TheSEED  :
    • Transcriptional regulator SarV (Staphylococcal accessory regulator V)
  • PFAM:
    HTH (CL0123) Staph_reg_Sar_Rot; Transcriptional regulator SarA/Rot (PF22381; HMM-score: 75.1)
    and 8 more
    MarR; MarR family (PF01047; HMM-score: 27.3)
    HTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 18.5)
    Penicillinase_R; Penicillinase repressor (PF03965; HMM-score: 18.4)
    DnaD_N; DnaD N-terminal domain (PF21984; HMM-score: 17.7)
    no clan defined SBDS_N; Shwachman-Bodian-Diamond syndrome (SBDS) N-terminal domain (PF01172; HMM-score: 17.1)
    GatB_YqeY (CL0279) GatB_Yqey; GatB domain (PF02637; HMM-score: 15)
    no clan defined DUF4874; Domain of unknown function (DUF4874) (PF16173; HMM-score: 14.3)
    GT-B (CL0113) Glyco_transf_28; Glycosyltransferase family 28 N-terminal domain (PF03033; HMM-score: 13.9)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.912
    • Cytoplasmic Membrane Score: 0.0545
    • Cell wall & surface Score: 0.0009
    • Extracellular Score: 0.0326
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.000785
    • TAT(Tat/SPI): 0.00015
    • LIPO(Sec/SPII): 0.000157
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MSNKVQRFIEAERELSQLKHWLKTTHKISIEEFVVLFKVYEAEKISGKELRDTLHFEMLWDTSKIDVIIRKIYKKELISKLRSETDERQVFYFYSTSQKKLLDKITKEIEVLSVTN

⊟Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Cytoplasmic [1]
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)

⊟Relevant publications[edit | edit source]