Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_002233 [new locus tag: EGJ38_RS11145 ]
- pan locus tag?: SAUPAN005724000
- symbol: sarV
- pan gene symbol?: sarV
- synonym:
- product: HTH-type transcriptional regulator SarV
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_002233 [new locus tag: EGJ38_RS11145 ]
- symbol: sarV
- product: HTH-type transcriptional regulator SarV
- replicon: chromosome
- strand: -
- coordinates: 2234902..2235252
- length: 351
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2424121 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGAGTAATAAAGTTCAACGTTTTATAGAAGCAGAAAGGGAGTTAAGTCAGTTAAAGCAC
TGGTTAAAAACAACACATAAGATTTCAATTGAAGAATTTGTAGTACTTTTTAAAGTGTAT
GAAGCTGAAAAGATTAGCGGTAAAGAATTGAGGGATACATTACATTTTGAAATGCTATGG
GATACAAGTAAAATCGATGTGATTATCCGTAAAATCTATAAAAAAGAGCTTATTTCTAAA
TTGCGTTCTGAAACGGATGAAAGACAAGTATTCTATTTCTATAGTACTTCTCAAAAGAAA
TTGTTAGATAAAATTACTAAAGAAATAGAAGTGTTAAGCGTTACAAACTAA60
120
180
240
300
351
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_002233 [new locus tag: EGJ38_RS11145 ]
- symbol: SarV
- description: HTH-type transcriptional regulator SarV
- length: 116
- theoretical pI: 9.64293
- theoretical MW: 13986.2
- GRAVY: -0.47069
⊟Function[edit | edit source]
- TIGRFAM: Regulatory functions DNA interactions staphylococcal accessory regulator family (TIGR01889; HMM-score: 86.5)and 4 moreTransport and binding proteins Cations and iron carrying compounds copper transport repressor, CopY/TcrY family (TIGR02698; HMM-score: 21.5)Regulatory functions DNA interactions copper transport repressor, CopY/TcrY family (TIGR02698; HMM-score: 21.5)homoprotocatechuate degradation operon regulator, HpaR (TIGR02337; HMM-score: 19.4)Purines, pyrimidines, nucleosides, and nucleotides 2'-Deoxyribonucleotide metabolism nrdI protein (TIGR00333; HMM-score: 13.8)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: HTH (CL0123) Staph_reg_Sar_Rot; Transcriptional regulator SarA/Rot (PF22381; HMM-score: 75.1)and 8 moreMarR; MarR family (PF01047; HMM-score: 27.3)HTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 18.5)Penicillinase_R; Penicillinase repressor (PF03965; HMM-score: 18.4)DnaD_N; DnaD N-terminal domain (PF21984; HMM-score: 17.7)no clan defined SBDS_N; Shwachman-Bodian-Diamond syndrome (SBDS) N-terminal domain (PF01172; HMM-score: 17.1)GatB_YqeY (CL0279) GatB_Yqey; GatB domain (PF02637; HMM-score: 15)no clan defined DUF4874; Domain of unknown function (DUF4874) (PF16173; HMM-score: 14.3)GT-B (CL0113) Glyco_transf_28; Glycosyltransferase family 28 N-terminal domain (PF03033; HMM-score: 13.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.912
- Cytoplasmic Membrane Score: 0.0545
- Cell wall & surface Score: 0.0009
- Extracellular Score: 0.0326
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.000785
- TAT(Tat/SPI): 0.00015
- LIPO(Sec/SPII): 0.000157
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2424121 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MSNKVQRFIEAERELSQLKHWLKTTHKISIEEFVVLFKVYEAEKISGKELRDTLHFEMLWDTSKIDVIIRKIYKKELISKLRSETDERQVFYFYSTSQKKLLDKITKEIEVLSVTN
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]