Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL2033 [new locus tag: SACOL_RS10610 ]
- pan locus tag?: SAUPAN005289000
- symbol: SACOL2033
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL2033 [new locus tag: SACOL_RS10610 ]
- symbol: SACOL2033
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2091442..2091666
- length: 225
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3236276 NCBI
- RefSeq: YP_186850 NCBI
- BioCyc: see SACOL_RS10610
- MicrobesOnline: 913506 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGATACACGAATTAGGTACAGTAGGAATGGTATGTCCATTTCCGTTAATTGAAGCGCAA
AAGAAAATGGCAACATTGCAATCTGGAGATGAATTAAAAATTGATTTTGATTGCACGCAA
GCGACGGAAGCCATTCCAAATTGGGCTGCAGAAAATGGTTATCCTGTAACAAACTATGAA
CAAATTGATAATGCTTCATGGACAATTACAATTCAAAAAGTTTAA60
120
180
225
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL2033 [new locus tag: SACOL_RS10610 ]
- symbol: SACOL2033
- description: hypothetical protein
- length: 74
- theoretical pI: 4.06448
- theoretical MW: 8230.32
- GRAVY: -0.159459
⊟Function[edit | edit source]
- TIGRFAM: selenium metabolism protein YedF (TIGR03527; HMM-score: 27.8)
- TheSEED :
- Hypothetical protein SAV2044
- PFAM: TusA-like (CL0397) TusA; Sulfurtransferase TusA (PF01206; HMM-score: 68.1)and 2 moreHeH (CL0306) Lsr2_DNA-bd; Lsr2 DNA-binding domain (PF23359; HMM-score: 13.1)Hybrid (CL0105) UPF1_1B_dom; RNA helicase UPF1, 1B domain (PF18141; HMM-score: 12.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9874
- Cytoplasmic Membrane Score: 0.0004
- Cell wall & surface Score: 0
- Extracellular Score: 0.0122
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.067895
- TAT(Tat/SPI): 0.002081
- LIPO(Sec/SPII): 0.009562
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MIHELGTVGMVCPFPLIEAQKKMATLQSGDELKIDFDCTQATEAIPNWAAENGYPVTNYEQIDNASWTITIQKV
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]