From AureoWiki
Jump to navigation Jump to search

NCBI: 06-JUL-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1951 [new locus tag: NWMN_RS11255 ]
  • pan locus tag?: SAUPAN005289000
  • symbol: NWMN_1951
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_1951 [new locus tag: NWMN_RS11255 ]
  • symbol: NWMN_1951
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2159825..2160049
  • length: 225
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGATACACGAATTAGGTACAGTAGGAATGGTATGTCCATTTCCGTTAATTGAAGCGCAA
    AAGAAAATGGCAACATTGCAATCTGGAGATGAATTAAAAATTGATTTTGATTGCACGCAA
    GCGACGGAAGCCATTCCAAATTGGGCTGCAGAAAATGGTTATCCTGTAACAAACTATGAA
    CAAATTGATAATGCTTCATGGACAATTACAATTCAAAAAGTTTAA
    60
    120
    180
    225

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_1951 [new locus tag: NWMN_RS11255 ]
  • symbol: NWMN_1951
  • description: hypothetical protein
  • length: 74
  • theoretical pI: 4.06448
  • theoretical MW: 8230.32
  • GRAVY: -0.159459

Function[edit | edit source]

  • TIGRFAM:
    selenium metabolism protein YedF (TIGR03527; HMM-score: 27.8)
  • TheSEED  :
    • Hypothetical protein SAV2044
  • PFAM:
    TusA-like (CL0397) TusA; Sulfurtransferase TusA (PF01206; HMM-score: 68.1)
    and 2 more
    HeH (CL0306) Lsr2_DNA-bd; Lsr2 DNA-binding domain (PF23359; HMM-score: 13.1)
    Hybrid (CL0105) UPF1_1B_dom; RNA helicase UPF1, 1B domain (PF18141; HMM-score: 12.8)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9874
    • Cytoplasmic Membrane Score: 0.0004
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0122
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.067895
    • TAT(Tat/SPI): 0.002081
    • LIPO(Sec/SPII): 0.009562
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MIHELGTVGMVCPFPLIEAQKKMATLQSGDELKIDFDCTQATEAIPNWAAENGYPVTNYEQIDNASWTITIQKV

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]