From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1921 [new locus tag: SACOL_RS10040 ]
  • pan locus tag?: SAUPAN004843000
  • symbol: bcp
  • pan gene symbol?: bcp
  • synonym:
  • product: bacterioferritin comigratory protein

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SACOL1921 [new locus tag: SACOL_RS10040 ]
  • symbol: bcp
  • product: bacterioferritin comigratory protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1984317..1984772
  • length: 456
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGTTGCAAAAAGGAGAACAATTTCCAATATTTAAATTAGAAAATCAAGACGGAACTGTC
    ATTACAAATGATACATTAAAAGGTAAAAAGGCGATTATATATTTTTATCCTAGAGATAAT
    ACACCTACTTGTACCACAGAAGCTTGTGACTTTAGAGACAATTTAGAAATGTTCAATGAT
    TTAGATGTTGCAGTATATGGTATAAGCGGTGATTCAAAGAAAAAACACCAAAATTTTATT
    GAGAAACACGGATTGAATTTCGATTTATTAGTAGATGAAGATTTTAAATTAGCTAAAGAA
    ACTGGCGTATATCAGTTAAAAAAATCATTTGGCAAAGAAAGTATGGGCATTGTAAGAACG
    ACTTTTATAATAGATGAACAAGGTAAAGTATTAGATGTTATCGAGAAGGTTAAGGTTAAA
    ACACAAATAGAAGAACTTAAAAACATTTTGGGGTGA
    60
    120
    180
    240
    300
    360
    420
    456


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SACOL1921 [new locus tag: SACOL_RS10040 ]
  • symbol: Bcp
  • description: bacterioferritin comigratory protein
  • length: 151
  • theoretical pI: 5.33808
  • theoretical MW: 17259.7
  • GRAVY: -0.450331

⊟Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Detoxification peroxiredoxin (TIGR03137; EC 1.11.1.15; HMM-score: 60.6)
    Cellular processes Cellular processes Adaptations to atypical conditions peroxiredoxin (TIGR03137; EC 1.11.1.15; HMM-score: 60.6)
  • TheSEED  :
    • Thiol peroxidase, Bcp-type (EC 1.11.1.24)
    Sulfur Metabolism Sulfur Metabolism - no subcategory Thioredoxin-disulfide reductase  Thiol peroxidase, Bcp-type (EC 1.11.1.15)
  • PFAM:
    Thioredoxin (CL0172) AhpC-TSA; AhpC/TSA family (PF00578; HMM-score: 126.8)
    and 5 more
    Redoxin; Redoxin (PF08534; HMM-score: 79.6)
    AhpC-TSA_2; AhpC/TSA antioxidant enzyme (PF13911; HMM-score: 18.2)
    SCO1-SenC; SCO1/SenC (PF02630; HMM-score: 15.1)
    DUF899; Bacterial protein of unknown function (DUF899) (PF05988; HMM-score: 13.2)
    no clan defined CIS_tube; Contractile injection system tube protein (PF19266; HMM-score: 11.6)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cellwall
    • Cytoplasmic Score: 0.11
    • Cytoplasmic Membrane Score: 0.93
    • Cellwall Score: 8.19
    • Extracellular Score: 0.77
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9413
    • Cytoplasmic Membrane Score: 0.0006
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.058
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.050865
    • TAT(Tat/SPI): 0.001169
    • LIPO(Sec/SPII): 0.003208
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MLQKGEQFPIFKLENQDGTVITNDTLKGKKAIIYFYPRDNTPTCTTEACDFRDNLEMFNDLDVAVYGISGDSKKKHQNFIEKHGLNFDLLVDEDFKLAKETGVYQLKKSFGKESMGIVRTTFIIDEQGKVLDVIEKVKVKTQIEELKNILG

⊟Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Cytoplasmic [1] [2] [3] [4]
  • quantitative data / protein copy number per cell: 929 [5]
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator: PerR* (repression) regulon
    PerR*(TF)important in Oxidative stress response; RegPrecise 

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: 21.89 h [6]

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. ↑ Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
    Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
    J Proteome Res: 2010, 9(3);1579-90
    [PubMed:20108986] [WorldCat.org] [DOI] (I p)
  3. ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J Proteome Res: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  4. ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  5. ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)
  6. ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
    Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
    Mol Cell Proteomics: 2012, 11(9);558-70
    [PubMed:22556279] [WorldCat.org] [DOI] (I p)

⊟Relevant publications[edit | edit source]