From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1537 [new locus tag: SACOL_RS07835 ]
  • pan locus tag?: SAUPAN004027000
  • symbol: scpB
  • pan gene symbol?: scpB
  • synonym:
  • product: segregation and condensation protein B

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL1537 [new locus tag: SACOL_RS07835 ]
  • symbol: scpB
  • product: segregation and condensation protein B
  • replicon: chromosome
  • strand: -
  • coordinates: 1575673..1576215
  • length: 543
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    TTGGATAATCATGGTATATTAGAGTCGCTTTTATTTACAGCTGGCGATGAAGGTTTAGAT
    GAAAAACAACTATTAGAAATATTAGATATGTCGAAAGACCAACTCGTTGAATTAATTGAA
    AATTATTCATCACATGGATTAATGATACAACGATTTGGAATGACGTATGTTTTAACGACT
    AAAAAAGAAGCGGCAACGTATATTGAACAATTAATTGAACAAAAGTCACAAATGAAATTA
    TCACAAGCAGCAATGGAAGTACTATCAATTATTGCTTATAACCAGCCATTATCAAGAAGT
    GATATTGAATTAATTCGTAGTATCAATTCAGATGGTGCAGTTAAGACATTGATTGCCAAA
    GGACTAGTTGAGGCTAAAGTGGTTAATGAACAGCGTAGCCAACAGTTAATTACTACTGAT
    TTATTTTTAAATGTATTTGGTATTTCCAATATAGAAGATTTGCCGACAACTGAAGAAGAC
    GATGAAGAAATGGATGCTTTTTTCAGTAATCTAGTCAATCAAAAAGGAGAAAATAATGAC
    TAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    543

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL1537 [new locus tag: SACOL_RS07835 ]
  • symbol: ScpB
  • description: segregation and condensation protein B
  • length: 180
  • theoretical pI: 4.03334
  • theoretical MW: 20235.7
  • GRAVY: -0.251667

Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Cell division segregation and condensation protein B (TIGR00281; HMM-score: 122.4)
    Genetic information processing DNA metabolism Chromosome-associated proteins segregation and condensation protein B (TIGR00281; HMM-score: 122.4)
  • TheSEED  :
    • Segregation and condensation protein B
    Cell Division and Cell Cycle Cell Division and Cell Cycle - no subcategory Two cell division clusters relating to chromosome partitioning  Segregation and condensation protein B
  • PFAM:
    HTH (CL0123) SMC_ScpB; Segregation and condensation complex subunit ScpB (PF04079; HMM-score: 138)
    and 4 more
    no clan defined NYD-SP12_N; Spermatogenesis-associated, N-terminal (PF15015; HMM-score: 14.4)
    HTH (CL0123) HTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 13.9)
    no clan defined DUF4760; Domain of unknown function (DUF4760) (PF15956; HMM-score: 13.5)
    Sigma54_AID; Sigma-54 factor, Activator interacting domain (AID) (PF00309; HMM-score: 10.3)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003773
    • TAT(Tat/SPI): 0.000246
    • LIPO(Sec/SPII): 0.000358
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MDNHGILESLLFTAGDEGLDEKQLLEILDMSKDQLVELIENYSSHGLMIQRFGMTYVLTTKKEAATYIEQLIEQKSQMKLSQAAMEVLSIIAYNQPLSRSDIELIRSINSDGAVKTLIAKGLVEAKVVNEQRSQQLITTDLFLNVFGISNIEDLPTTEEDDEEMDAFFSNLVNQKGENND

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Cytoplasmic [1] [2] [3]
  • quantitative data / protein copy number per cell: 205 [4]
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: 21.08 h [5]

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J Proteome Res: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  3. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  4. Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)
  5. Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
    Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
    Mol Cell Proteomics: 2012, 11(9);558-70
    [PubMed:22556279] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]