Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL1379 [new locus tag: SACOL_RS07020 ]
- pan locus tag?: SAUPAN003719000
- symbol: SACOL1379
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL1379 [new locus tag: SACOL_RS07020 ]
- symbol: SACOL1379
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 1382822..1382920
- length: 99
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3237337 NCBI
- RefSeq: YP_186232 NCBI
- BioCyc: see SACOL_RS07020
- MicrobesOnline: 912838 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61GTGCGAAAAAGTAAATTCGCAATTGATAGAGGCTATTTTCCAGATATGGAAATGGCCTCT
TTTTATAATCAAATTAATAAGAATAAATATGTTTATTAA60
99
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL1379 [new locus tag: SACOL_RS07020 ]
- symbol: SACOL1379
- description: hypothetical protein
- length: 32
- theoretical pI: 9.91484
- theoretical MW: 3956.55
- GRAVY: -0.84375
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED:
- PFAM:
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MRKSKFAIDRGYFPDMEMASFYNQINKNKYVY
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available