From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1378 [new locus tag: SACOL_RS07015 ]
  • pan locus tag?: SAUPAN003718000
  • symbol: SACOL1378
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL1378 [new locus tag: SACOL_RS07015 ]
  • symbol: SACOL1378
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1382593..1382835
  • length: 243
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGGCAACTTGGTTAGCAATTATTTTTATAGTAGCTGCATTAATTTTAGGTTTAATTGGA
    GGTTTCCTTTTAGCTAGAAAATATATGATGGACTACTTGAAGAAAAACCCACCAATCAAC
    GAAGAAATGCTTCGTATGATGATGATGCAAATGGGTCAAAAACCTTCTCAGAAGAAAATT
    AATCAAATGATGACGATGATGAATAAAAATATGGATCAAAATATGAAGAGTGCGAAAAAG
    TAA
    60
    120
    180
    240
    243

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL1378 [new locus tag: SACOL_RS07015 ]
  • symbol: SACOL1378
  • description: hypothetical protein
  • length: 80
  • theoretical pI: 10.8463
  • theoretical MW: 9319.56
  • GRAVY: -0.03

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • UPF0154 membrane protein YoxG
  • PFAM:
    no clan defined UPF0154; Uncharacterised protein family (UPF0154) (PF03672; HMM-score: 102.7)
    and 2 more
    CATSPERE_NTD2; CATSPERE second N-terminal domain (PF22843; HMM-score: 16.3)
    E-set (CL0159) DUF4179; Domain of unknown function (DUF4179) (PF13786; HMM-score: 15.4)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.9951
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0049
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -0.5
    • N-terminally Anchored Score: 7
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.059004
    • TAT(Tat/SPI): 0.001484
    • LIPO(Sec/SPII): 0.029154
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MATWLAIIFIVAALILGLIGGFLLARKYMMDYLKKNPPINEEMLRMMMMQMGQKPSQKKINQMMTMMNKNMDQNMKSAKK

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Signal peptide containing [1] [2]
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]