Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL1076 [new locus tag: SACOL_RS05490 ]
- pan locus tag?: SAUPAN003280000
- symbol: purS
- pan gene symbol?: purS
- synonym:
- product: phosphoribosylformylglycinamidine synthase, PurS protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL1076 [new locus tag: SACOL_RS05490 ]
- symbol: purS
- product: phosphoribosylformylglycinamidine synthase, PurS protein
- replicon: chromosome
- strand: +
- coordinates: 1085223..1085486
- length: 264
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3237671 NCBI
- RefSeq: YP_185940 NCBI
- BioCyc: see SACOL_RS05490
- MicrobesOnline: 912544 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGAAAACAATTGAACTACATATCACATTACAACCACAAGTATTAGATACGCAAGGACAA
ACGCTTACTCGAGCTGTACATGACTTAGGTTATGCACAAGTGAATGATATTCGTGTAGGA
AAAGTATTATATATGACAGTGGATGAGGTTAGTGATGAAAAGGTACACAACATTATTACA
ACTCTAAGTGAAAAATTGTTTGCAAATACAGTGATTGAAGAATATAGCTATAAAGTGTTA
GATGATGAAAAGGAGAATGCATAA60
120
180
240
264
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL1076 [new locus tag: SACOL_RS05490 ]
- symbol: PurS
- description: phosphoribosylformylglycinamidine synthase, PurS protein
- length: 87
- theoretical pI: 4.46527
- theoretical MW: 9921.15
- GRAVY: -0.295402
⊟Function[edit | edit source]
- reaction: EC 6.3.5.3? ExPASyPhosphoribosylformylglycinamidine synthase ATP + N2-formyl-N1-(5-phospho-D-ribosyl)glycinamide + L-glutamine + H2O = ADP + phosphate + 2-(formamido)-N1-(5-phospho-D-ribosyl)acetamidine + L-glutamate
- TIGRFAM: Purines, pyrimidines, nucleosides, and nucleotides Purine ribonucleotide biosynthesis phosphoribosylformylglycinamidine synthase, purS protein (TIGR00302; HMM-score: 73.1)
- TheSEED :
- Phosphoribosylformylglycinamidine synthase, PurS subunit (EC 6.3.5.3)
- PFAM: no clan defined PurS; Phosphoribosylformylglycinamidine (FGAM) synthase (PF02700; HMM-score: 81.1)and 2 moreT3RM_EcoP15I_C; Type III R-M EcoP15I C-terminal domain (PF18273; HMM-score: 14.9)DUF3333; Domain of unknown function (DUF3333) (PF11812; HMM-score: 14.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9981
- Cytoplasmic Membrane Score: 0.0005
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0013
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.006483
- TAT(Tat/SPI): 0.000384
- LIPO(Sec/SPII): 0.000822
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKTIELHITLQPQVLDTQGQTLTRAVHDLGYAQVNDIRVGKVLYMTVDEVSDEKVHNIITTLSEKLFANTVIEEYSYKVLDDEKENA
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2]
- quantitative data / protein copy number per cell: 2546 [3]
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: 72.6 h [4]
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e) - ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
Mol Cell Proteomics: 2012, 11(9);558-70
[PubMed:22556279] [WorldCat.org] [DOI] (I p)