From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1063 [new locus tag: SACOL_RS05420 ]
  • pan locus tag?: SAUPAN003261000
  • symbol: SACOL1063
  • pan gene symbol?: —
  • synonym:
  • product: acetyltransferase

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SACOL1063 [new locus tag: SACOL_RS05420 ]
  • symbol: SACOL1063
  • product: acetyltransferase
  • replicon: chromosome
  • strand: -
  • coordinates: 1071691..1072125
  • length: 435
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGTTTTCAAAAGTAAACAATCAAAAGATGTTAGAAGATTGCTTCTATATAAGAAAGAAA
    GTGTTTGTAGAAGAACAAGGCGTCCCTGAGGAAAGTGAAATTGATGAATATGAATCTGAA
    TCTATTCACCTCATTGGATATGATAATGGACAGCCAGTTGCCACTGCTCGAATACGCCCT
    ATTAATGAAACAACTGTCAAAATAGAACGAGTAGCTGTGATGAAATCACATCGTGGACAA
    GGAATGGGTAGAATGCTTATGCAAGCTGTAGAATCATTAGCTAAAGATGAAGGTTTTTAC
    GTAGCTACTATGAATGCCCAATGTCATGCTATCCCATTTTATGAAAGTTTAAACTTTAAA
    ATGAGAGGTAATATATTTCTTGAGGAAGGCATCGAGCATATTGAAATGACAAAAAAGTTA
    ACCTCGCTTAATTAA
    60
    120
    180
    240
    300
    360
    420
    435


⊟Protein[edit | edit source]

Protein Data Bank: 5JPH
Protein Data Bank: 5JQ4

⊟General[edit | edit source]

  • locus tag: SACOL1063 [new locus tag: SACOL_RS05420 ]
  • symbol: SACOL1063
  • description: acetyltransferase
  • length: 144
  • theoretical pI: 5.30054
  • theoretical MW: 16555.9
  • GRAVY: -0.405556

⊟Function[edit | edit source]

  • reaction:
    EC 2.3.1.-?  ExPASy
  • TIGRFAM:
    putative N-acetyltransferase, MSMEG_0567 N-terminal domain family (TIGR04045; HMM-score: 38.8)
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal-protein-alanine acetyltransferase (TIGR01575; EC 2.3.1.128; HMM-score: 31.4)
    and 5 more
    N-acyl amino acid synthase, PEP-CTERM/exosortase system-associated (TIGR03694; EC 2.3.1.-; HMM-score: 17.8)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides TDP-D-fucosamine acetyltransferase (TIGR02382; HMM-score: 15.5)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Glutathione and analogs mycothiol synthase (TIGR03448; EC 2.3.1.189; HMM-score: 15.3)
    Cellular processes Cellular processes Adaptations to atypical conditions diaminobutyrate acetyltransferase (TIGR02406; EC 2.3.1.178; HMM-score: 14.5)
    putative beta-lysine N-acetyltransferase (TIGR03827; EC 2.3.1.-; HMM-score: 12.5)
  • TheSEED  :
    • GNAT family acetyltransferase YjcF
    Experimental tye  GNAT family acetyltransferase YjcF
  • PFAM:
    Acetyltrans (CL0257) Acetyltransf_1; Acetyltransferase (GNAT) family (PF00583; HMM-score: 69.3)
    Acetyltransf_10; Acetyltransferase (GNAT) domain (PF13673; HMM-score: 65.5)
    Acetyltransf_7; Acetyltransferase (GNAT) domain (PF13508; HMM-score: 57.1)
    and 7 more
    Acetyltransf_CG; GCN5-related N-acetyl-transferase (PF14542; HMM-score: 25.9)
    Acetyltransf_9; Acetyltransferase (GNAT) domain (PF13527; HMM-score: 24.6)
    Acetyltransf_5; Acetyltransferase (GNAT) domain (PF13444; HMM-score: 21.2)
    FR47; FR47-like protein (PF08445; HMM-score: 20.2)
    FeeM; N-acyl amino acid synthase FeeM (PF21926; HMM-score: 18.2)
    IDM1_C; Increased DNA methylation 1, C-terminal (PF23209; HMM-score: 14.9)
    Acetyltransf_15; Putative acetyl-transferase (PF17013; HMM-score: 12.7)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9987
    • Cytoplasmic Membrane Score: 0.0002
    • Cell wall & surface Score: 0.0002
    • Extracellular Score: 0.0009
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003957
    • TAT(Tat/SPI): 0.000261
    • LIPO(Sec/SPII): 0.000439
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MFSKVNNQKMLEDCFYIRKKVFVEEQGVPEESEIDEYESESIHLIGYDNGQPVATARIRPINETTVKIERVAVMKSHRGQGMGRMLMQAVESLAKDEGFYVATMNAQCHAIPFYESLNFKMRGNIFLEEGIEHIEMTKKLTSLN

⊟Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Cytoplasmic [1] [2] [3]
  • quantitative data / protein copy number per cell: 49 [4]
  • interaction partners:
    SACOL0593(fusA)elongation factor G  [5] (data from MRSA252)
    SACOL0838(gapA1)glyceraldehyde 3-phosphate dehydrogenase  [5] (data from MRSA252)
    SACOL2238(rplD)50S ribosomal protein L4  [5] (data from MRSA252)
    SACOL2206(rpsI)30S ribosomal protein S9  [5] (data from MRSA252)

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J Proteome Res: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  3. ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  4. ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)
  5. ↑ 5.0 5.1 5.2 5.3 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

⊟Relevant publications[edit | edit source]