Jump to navigation
		Jump to search
		
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL0953 [new locus tag: SACOL_RS04885 ]
- pan locus tag?: SAUPAN003051000
- symbol: mnhC
- pan gene symbol?: mnhC1
- synonym:
- product: monovalent cation/H+ antiporter subunit C
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL0953 [new locus tag: SACOL_RS04885 ]
- symbol: mnhC
- product: monovalent cation/H+ antiporter subunit C
- replicon: chromosome
- strand: -
- coordinates: 954401..954742
- length: 342
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3237714 NCBI
- RefSeq: YP_185822 NCBI
- BioCyc: see SACOL_RS04885
- MicrobesOnline: 912423 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
 61
 121
 181
 241
 301GTGGAAATTATTATGATTTTTGTTAGTGGTATTCTCACAGCAATTAGTGTCTATCTCGTT
 TTGTCTAAAAGTCTGATACGAATTGTTATGGGAACTACACTATTAACACATGCAGCAAAT
 TTATTTTTAATAACTATGGGCGGACTTAAACATGGTACTGTTCCAATTTATGAAGCGAAC
 GTAAAAAGCTATGTTGATCCTATCCCGCAAGCACTTATTTTAACAGCAATCGTTATCGCC
 TTTGCGACAACAGCCTTTTTCTTAGTATTAGCATTTAGAACATATAAAGAATTAGGCACA
 GATAACGTTGAGAGTATGAAAGGAGTTCCAGAAGATGATTGA60
 120
 180
 240
 300
 342
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL0953 [new locus tag: SACOL_RS04885 ]
- symbol: MnhC
- description: monovalent cation/H+ antiporter subunit C
- length: 113
- theoretical pI: 5.61663
- theoretical MW: 12292.6
- GRAVY: 0.839823
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Cations and iron carrying compounds multicomponent Na+:H+ antiporter, MnhC subunit (TIGR00941; HMM-score: 175.7)
- TheSEED  : - Na(+) H(+) antiporter subunit C (TC 2.A.63.1.3)
 
- PFAM: no clan defined Oxidored_q2; NADH-ubiquinone/plastoquinone oxidoreductase chain 4L (PF00420; HMM-score: 97.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 3
 
- DeepLocPro: Cytoplasmic Membrane- Cytoplasmic Score: 0.0001
- Cytoplasmic Membrane Score: 0.9986
- Cell wall & surface Score: 0
- Extracellular Score: 0.0013
 
- LocateP: Multi-transmembrane - Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
 
- SignalP: no predicted signal peptide- SP(Sec/SPI): 0.133377
- TAT(Tat/SPI): 0.003616
- LIPO(Sec/SPII): 0.004539
 
- predicted transmembrane helices (TMHMM): 3
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MEIIMIFVSGILTAISVYLVLSKSLIRIVMGTTLLTHAANLFLITMGGLKHGTVPIYEANVKSYVDPIPQALILTAIVIAFATTAFFLVLAFRTYKELGTDNVESMKGVPEDD
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Regulation[edit | edit source]
- data available for JSNZ
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker  
 A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
 PLoS One: 2009, 4(12);e8176
 [PubMed:19997597] [WorldCat.org] [DOI] (I e)
- ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher  
 The Staphylococcus aureus proteome.
 Int J Med Microbiol: 2014, 304(2);110-20
 [PubMed:24439828] [WorldCat.org] [DOI] (I p)