Jump to navigation
Jump to search
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_0820 [new locus tag: NWMN_RS04635 ]
- pan locus tag?: SAUPAN003051000
- symbol: mnhC
- pan gene symbol?: mnhC1
- synonym:
- product: putative monovalent cation/H+ antiporter subunit C
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_0820 [new locus tag: NWMN_RS04635 ]
- symbol: mnhC
- product: putative monovalent cation/H+ antiporter subunit C
- replicon: chromosome
- strand: -
- coordinates: 907574..907972
- length: 399
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5332142 NCBI
- RefSeq: YP_001331854 NCBI
- BioCyc:
- MicrobesOnline: 3706369 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGTGCAGTAGTTGGTACTGTCATGACAATTATTATTTCGATTGGAGAGAACGAATAGTG
GAAATTATTATGATTTTTGTTAGTGGTATTCTCACAGCAATTAGTGTCTATCTCGTTTTG
TCTAAAAGTCTGATACGAATTGTTATGGGAACTACACTATTAACACATGCAGCAAATTTA
TTTTTAATAACTATGGGCGGACTTAAACATGGTACTGTTCCAATTTATGAAGCGAACGTA
AAAAGCTATGTTGATCCTATCCCGCAAGCACTTATTTTAACAGCAATCGTTATCGCCTTT
GCGACAACAGCCTTTTTCTTAGTATTAGCATTTAGAACATATAAAGAATTAGGCACAGAT
AACGTTGAGAGTATGAAAGGAGTTCCAGAAGATGATTGA60
120
180
240
300
360
399
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_0820 [new locus tag: NWMN_RS04635 ]
- symbol: MnhC
- description: putative monovalent cation/H+ antiporter subunit C
- length: 132
- theoretical pI: 5.57988
- theoretical MW: 14817.3
- GRAVY: 0.590151
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Cations and iron carrying compounds multicomponent Na+:H+ antiporter, MnhC subunit (TIGR00941; HMM-score: 172.5)and 1 morecxxc_20_cxxc protein (TIGR04104; HMM-score: 10.6)
- TheSEED :
- Na(+) H(+) antiporter subunit C (TC 2.A.63.1.3)
- PFAM: no clan defined Oxidored_q2; NADH-ubiquinone/plastoquinone oxidoreductase chain 4L (PF00420; HMM-score: 97)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 2
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0019
- Cytoplasmic Membrane Score: 0.9933
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0048
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003375
- TAT(Tat/SPI): 0.000097
- LIPO(Sec/SPII): 0.002195
- predicted transmembrane helices (TMHMM): 3
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MCSSWYCHDNYYFDWRERIVEIIMIFVSGILTAISVYLVLSKSLIRIVMGTTLLTHAANLFLITMGGLKHGTVPIYEANVKSYVDPIPQALILTAIVIAFATTAFFLVLAFRTYKELGTDNVESMKGVPEDD
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- data available for JSNZ
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]