Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL0741 [new locus tag: SACOL_RS03805 ]
- pan locus tag?: SAUPAN002565000
- symbol: SACOL0741
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL0741 [new locus tag: SACOL_RS03805 ]
- symbol: SACOL0741
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 762031..762489
- length: 459
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3237146 NCBI
- RefSeq: YP_185620 NCBI
- BioCyc: see SACOL_RS03805
- MicrobesOnline: 912216 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421GTGACACATATTATTATTGATGGAGATGCTTGTCCTGTTGTTGATTCTATTATAGATTTA
ACAACTGAGACAGGCATTTTTGTGACAATTATTCGGAGCTTCAGCCATTTTTCGAACCAA
TTATATCCTCCACATGTATCAACATTATATGTTGATGATGGACCAGATGCAGTTGATTAC
AAAATTGTTCAATTATCAACGAAGGATGATATCGTAGTCACTCAAGATTATGGACTCGCA
AGTTTATTAGTCGACAAAGTCTTAATTGTCATGCATCATAATGGGAAGATATACAATTCC
AAAAATATTCAACAACTATTAGATAAACGATATATGAATGCACAAATTAGAAAACAAGGT
GGTCGCCACAAAGGTCCCCCACCTTTTACAAAGCAAGATCAAAAAGTGTTTGAACAATCA
CTATTAAAAGTCATTCATCGAATTAAGGAGCTGGATTAA60
120
180
240
300
360
420
459
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL0741 [new locus tag: SACOL_RS03805 ]
- symbol: SACOL0741
- description: hypothetical protein
- length: 152
- theoretical pI: 7.23211
- theoretical MW: 17257.7
- GRAVY: -0.219079
⊟Function[edit | edit source]
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9669
- Cytoplasmic Membrane Score: 0.0298
- Cell wall & surface Score: 0.0006
- Extracellular Score: 0.0028
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.001461
- TAT(Tat/SPI): 0.000095
- LIPO(Sec/SPII): 0.000234
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MTHIIIDGDACPVVDSIIDLTTETGIFVTIIRSFSHFSNQLYPPHVSTLYVDDGPDAVDYKIVQLSTKDDIVVTQDYGLASLLVDKVLIVMHHNGKIYNSKNIQQLLDKRYMNAQIRKQGGRHKGPPPFTKQDQKVFEQSLLKVIHRIKELD
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2]
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: SigB* (activation) regulon
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
J Bacteriol: 2004, 186(13);4085-99
[PubMed:15205410] [WorldCat.org] [DOI] (P p) - ↑ Jan Pané-Farré, Beate Jonas, Konrad Förstner, Susanne Engelmann, Michael Hecker
The sigmaB regulon in Staphylococcus aureus and its regulation.
Int J Med Microbiol: 2006, 296(4-5);237-58
[PubMed:16644280] [WorldCat.org] [DOI] (P p)