Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL0618 [new locus tag: SACOL_RS03195 ]
- pan locus tag?: SAUPAN002348000
- symbol: SACOL0618
- pan gene symbol?: hxlB
- synonym:
- product: SIS domain-containing protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL0618 [new locus tag: SACOL_RS03195 ]
- symbol: SACOL0618
- product: SIS domain-containing protein
- replicon: chromosome
- strand: +
- coordinates: 650992..651540
- length: 549
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3236743 NCBI
- RefSeq: YP_185503 NCBI
- BioCyc: see SACOL_RS03195
- MicrobesOnline: 912098 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541ATGGCTAAATTTAGTGACTATCAATTAATTCTAGATGAATTAAAGATGACTTTGTCACAT
GTTGAAGCGGATGAGTTTTCAACTTTTGCATCCAAAATACTACATGCTGAACATATATTT
GTAGCTGGCAAAGGACGTTCAGGATTCGTGGCGAATAGTTTTGCAATGCGCTTAAATCAG
CTCGGCAAACAGGCACATGTTGTTGGAGAATCAACGACACCTGCGATTAAGTCGAATGAT
GTATTTGTAATTATCTCTGGTTCAGGTTCCACGGAACATTTAAGATTATTAGCAGACAAA
GCAAAATCAGTAGGTGCTGACATCGTATTAATTACTACAAATAAAGATTCTGCAATAGGC
AATCTAGCTGGGACGAACATCGTTTTGCCTGCAGGTACAAAATATGATGAACAAGGCTCG
GCACAACCATTAGGAAGTTTGTTTGAACAAGCATCTCAATTATTTTTAGATAGTGTTGTA
ATGGGATTGATGACTGAAATGAATGTTACGGAACAAACGATGCAACAAAATCATGCTAAT
TTAGAATAA60
120
180
240
300
360
420
480
540
549
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL0618 [new locus tag: SACOL_RS03195 ]
- symbol: SACOL0618
- description: SIS domain-containing protein
- length: 182
- theoretical pI: 5.19307
- theoretical MW: 19558.1
- GRAVY: -0.00274725
⊟Function[edit | edit source]
- TIGRFAM: 6-phospho 3-hexuloisomerase (TIGR03127; EC 5.3.-.-; HMM-score: 226.1)and 6 moreEnergy metabolism Sugars sugar isomerase, KpsF/GutQ family (TIGR00393; HMM-score: 29.7)Cell envelope Biosynthesis and degradation of murein sacculus and peptidoglycan N-acetylmuramic acid 6-phosphate etherase (TIGR00274; EC 4.2.1.126; HMM-score: 23.2)Cell envelope Biosynthesis and degradation of murein sacculus and peptidoglycan glutamine-fructose-6-phosphate transaminase (isomerizing) (TIGR01135; EC 2.6.1.16; HMM-score: 20)Central intermediary metabolism Amino sugars glutamine-fructose-6-phosphate transaminase (isomerizing) (TIGR01135; EC 2.6.1.16; HMM-score: 20)bifunctional phosphoglucose/phosphomannose isomerase (TIGR02128; EC 5.3.1.9; HMM-score: 18)Purines, pyrimidines, nucleosides, and nucleotides Purine ribonucleotide biosynthesis phosphoribosylglycinamide formyltransferase (TIGR00639; EC 2.1.2.2; HMM-score: 12.2)
- TheSEED :
- 6-phospho-3-hexuloisomerase (EC 5.3.1.27)
Carbohydrates One-carbon Metabolism Formaldehyde assimilation: Ribulose monophosphate pathway 6-phospho-3-hexuloisomeraseand 1 more - PFAM: SIS (CL0067) SIS; SIS domain (PF01380; HMM-score: 68.5)and 2 moreSIS_2; SIS domain (PF13580; HMM-score: 22.6)no clan defined Formyl_trans_N; Formyl transferase (PF00551; HMM-score: 13.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9951
- Cytoplasmic Membrane Score: 0.0019
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0028
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003823
- TAT(Tat/SPI): 0.000787
- LIPO(Sec/SPII): 0.000218
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MAKFSDYQLILDELKMTLSHVEADEFSTFASKILHAEHIFVAGKGRSGFVANSFAMRLNQLGKQAHVVGESTTPAIKSNDVFVIISGSGSTEHLRLLADKAKSVGADIVLITTNKDSAIGNLAGTNIVLPAGTKYDEQGSAQPLGSLFEQASQLFLDSVVMGLMTEMNVTEQTMQQNHANLE
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2] [3]
- quantitative data / protein copy number per cell: 734 [4]
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: SigB* (activation) regulon
SigB* (sigma factor) controlling a large regulon involved in stress/starvation response and adaptation; [5] other strains
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: 29.99 h [6]
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e) - ↑ Jan Pané-Farré, Beate Jonas, Konrad Förstner, Susanne Engelmann, Michael Hecker
The sigmaB regulon in Staphylococcus aureus and its regulation.
Int J Med Microbiol: 2006, 296(4-5);237-58
[PubMed:16644280] [WorldCat.org] [DOI] (P p) - ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
Mol Cell Proteomics: 2012, 11(9);558-70
[PubMed:22556279] [WorldCat.org] [DOI] (I p)

