From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0615 [new locus tag: SACOL_RS03180 ]
  • pan locus tag?: SAUPAN002345000
  • symbol: SACOL0615
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SACOL0615 [new locus tag: SACOL_RS03180 ]
  • symbol: SACOL0615
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 648885..649247
  • length: 363
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    GTGTTGGAACCAATTAAAGAACAAGAAGTTATAGATTTACTTGCTTCTTTTGAACATAAA
    CCTGTGTATCTGCATGTTGAAACGACAAATGGGGCCTATGCGAACCATTTCGATCAACGT
    GTTTTTAATGCTGGTACTTTTTTAAGAAACATACAAATAACATATACGCATGCACAACTA
    AAAGGTGGTAATAAAGAACCTTATCGCATTGGTCTTAAACTATCAAATGGTGGTTGGGTT
    TATGTACAAGGTCTAACGCATTTTGAGGTCAATGAGCATGATGAATTTTTAATTGCAGGT
    TTTAATTACGAAGGTCAACTCGCTGCAGCACTTCAAATTAGTGAGCGACCATTTAATTTA
    TAG
    60
    120
    180
    240
    300
    360
    363


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SACOL0615 [new locus tag: SACOL_RS03180 ]
  • symbol: SACOL0615
  • description: hypothetical protein
  • length: 120
  • theoretical pI: 5.8997
  • theoretical MW: 13693.3
  • GRAVY: -0.305

⊟Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • FIG011895: hypothetical protein
  • PFAM:
    no clan defined DUF1806; Protein of unknown function (DUF1806) (PF08830; HMM-score: 162.2)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.835
    • Cytoplasmic Membrane Score: 0.0971
    • Cell wall & surface Score: 0.0003
    • Extracellular Score: 0.0677
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.028478
    • TAT(Tat/SPI): 0.000501
    • LIPO(Sec/SPII): 0.000475
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MLEPIKEQEVIDLLASFEHKPVYLHVETTNGAYANHFDQRVFNAGTFLRNIQITYTHAQLKGGNKEPYRIGLKLSNGGWVYVQGLTHFEVNEHDEFLIAGFNYEGQLAAALQISERPFNL

⊟Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Cytoplasmic [1] [2]
  • quantitative data / protein copy number per cell: 364 [3]
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  3. ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)

⊟Relevant publications[edit | edit source]