Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL0560 [new locus tag: SACOL_RS02865 ]
- pan locus tag?: SAUPAN002258000
- symbol: folK
- pan gene symbol?: folK
- synonym:
- product: 2-amino-4-hydroxy-6- hydroxymethyldihydropteridine pyrophosphokinase
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL0560 [new locus tag: SACOL_RS02865 ]
- symbol: folK
- product: 2-amino-4-hydroxy-6- hydroxymethyldihydropteridine pyrophosphokinase
- replicon: chromosome
- strand: +
- coordinates: 569392..569868
- length: 477
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3237128 NCBI
- RefSeq: YP_185448 NCBI
- BioCyc: see SACOL_RS02865
- MicrobesOnline: 912032 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGATTCAAGCATACTTAGGATTAGGTAGTAATATTGGTGATAGAGAAAGCCAGTTAAAC
GATGCTATAAAGATTTTGAATGAATATGATGGTATTAACGTATCTAATATTTCTCCGATT
TATGAAACAGCACCAGTTGGGTATACTGAGCAACCTAACTTTTTAAATTTGTGTGTTGAA
ATTCAAACAACACTCACAGTATTACAACTGTTGGAATGTTGTTTGAAGACAGAAGAATGT
TTACACCGTATTAGAAAGGAACGATGGGGTCCTAGAACTTTAGATGTGGATATTTTGTTG
TATGGAGAAGAAATGATAGATTTACCAAAACTGTCGGTGCCACATCCGAGAATGAATGAA
CGTGCATTTGTTTTAATCCCATTAAATGATATAGCAGCAAATGTCGTAGAACCACGTTCG
AAATTGAAAGTGAAAGATTTAGTTTTTGTCGATGACAGTGTAAAGAGATATAAATAA60
120
180
240
300
360
420
477
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL0560 [new locus tag: SACOL_RS02865 ]
- symbol: FolK
- description: 2-amino-4-hydroxy-6- hydroxymethyldihydropteridine pyrophosphokinase
- length: 158
- theoretical pI: 4.84673
- theoretical MW: 18028.8
- GRAVY: -0.149367
⊟Function[edit | edit source]
- reaction: EC 2.7.6.3? ExPASy2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase ATP + 6-hydroxymethyl-7,8-dihydropterin = AMP + 6-hydroxymethyl-7,8-dihydropterin diphosphate
- TIGRFAM: Biosynthesis of cofactors, prosthetic groups, and carriers Folic acid 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase (TIGR01498; EC 2.7.6.3; HMM-score: 150.3)
- TheSEED :
- 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC 2.7.6.3)
- PFAM: no clan defined HPPK; 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK) (PF01288; HMM-score: 139.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9917
- Cytoplasmic Membrane Score: 0.0002
- Cell wall & surface Score: 0
- Extracellular Score: 0.0082
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.006796
- TAT(Tat/SPI): 0.000391
- LIPO(Sec/SPII): 0.001991
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MIQAYLGLGSNIGDRESQLNDAIKILNEYDGINVSNISPIYETAPVGYTEQPNFLNLCVEIQTTLTVLQLLECCLKTEECLHRIRKERWGPRTLDVDILLYGEEMIDLPKLSVPHPRMNERAFVLIPLNDIAANVVEPRSKLKVKDLVFVDDSVKRYK
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2] [3]
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: folP > folB > folK
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)