Jump to navigation
		Jump to search
		
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA1910 [new locus tag: SA_RS10990 ]
- pan locus tag?: SAUPAN005399000
- symbol: atpE
- pan gene symbol?: atpE
- synonym:
- product: ATP synthase F0F1 subunit C
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA1910 [new locus tag: SA_RS10990 ]
- symbol: atpE
- product: ATP synthase F0F1 subunit C
- replicon: chromosome
- strand: -
- coordinates: 2160718..2160930
- length: 213
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1124811 NCBI
- RefSeq: NP_375215 NCBI
- BioCyc: see SA_RS10990
- MicrobesOnline: 104241 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
 61
 121
 181ATGAATTTAATCGCAGCAGCAATCGCAATTGGTTTATCAGCATTAGGAGCAGGTATCGGT
 AACGGTTTAATCGTTTCAAGAACAGTTGAAGGTGTAGCACGTCAACCAGAAGCACGTGGT
 CAATTAATGGGTATCATGTTCATTGGTGTAGGTTTAGTTGAGGCATTACCTATCATCGGT
 GTAGTAATTGCATTCATGACATTTGCTGGATAA60
 120
 180
 213
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA1910 [new locus tag: SA_RS10990 ]
- symbol: AtpE
- description: ATP synthase F0F1 subunit C
- length: 70
- theoretical pI: 6.61182
- theoretical MW: 6979.38
- GRAVY: 1.25429
⊟Function[edit | edit source]
- reaction: EC 3.6.3.14? ExPASyH+-transporting two-sector ATPase ATP + H2O + H+(In) = ADP + phosphate + H+(Out)
- TIGRFAM: Energy metabolism ATP-proton motive force interconversion ATP synthase F0, C subunit (TIGR01260; EC 3.6.3.14; HMM-score: 73.7)and 1 morealternate F1F0 ATPase, F0 subunit C (TIGR03322; EC 3.6.3.-; HMM-score: 31.8)
- TheSEED  : - ATP synthase F0 sector subunit c (EC 7.1.2.2)
 
- PFAM: no clan defined ATP-synt_C; ATP synthase subunit C (PF00137; HMM-score: 64.4)and 1 moreDUF5362; Family of unknown function (DUF5362) (PF17319; HMM-score: 13.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 2
 
- DeepLocPro: Cytoplasmic Membrane- Cytoplasmic Score: 0.0002
- Cytoplasmic Membrane Score: 0.9584
- Cell wall & surface Score: 0
- Extracellular Score: 0.0414
 
- LocateP: Multi-transmembrane - Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0
- Signal peptide possibility: -0.5
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
 
- SignalP: no predicted signal peptide- SP(Sec/SPI): 0.064922
- TAT(Tat/SPI): 0.003265
- LIPO(Sec/SPII): 0.180633
 
- predicted transmembrane helices (TMHMM): 2
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MNLIAAAIAIGLSALGAGIGNGLIVSRTVEGVARQPEARGQLMGIMFIGVGLVEALPIIGVVIAFMTFAG
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]