Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA1247 [new locus tag: SA_RS07075 ]
- pan locus tag?: SAUPAN003835000
- symbol: SA1247
- pan gene symbol?: arlR
- synonym:
- product: truncated ( response regulator ArlR
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA1247 [new locus tag: SA_RS07075 ]
- symbol: SA1247
- product: truncated ( response regulator ArlR
- replicon: chromosome
- strand: -
- coordinates: 1423544..1423789
- length: 246
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3251084 NCBI
- RefSeq: NP_374528 NCBI
- BioCyc: see SA_RS07075
- MicrobesOnline: 103554 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241GTGACGGTAAATGGCGCAGAAATTGAATTAACAAAAACAGAGTATGATTTACTATATCTT
CTAGCTGAAAATAAAAACCATGTTATGCAACGGGAACAAATTTTAAATCATGTATGGGGT
TATAATAGTGAAGTAGAAACAAATGTCGTAGATGTTTATATAAGATATTTACGAAACAAG
TTAAAACCATACGATCGTGACAAAATGATTGAAACAGTTCGTGGCGTTGGGTATGTGATA
CGATGA60
120
180
240
246
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA1247 [new locus tag: SA_RS07075 ]
- symbol: SA1247
- description: truncated ( response regulator ArlR
- length: 81
- theoretical pI: 6.52603
- theoretical MW: 9663
- GRAVY: -0.490123
⊟Function[edit | edit source]
- TIGRFAM: Regulatory functions DNA interactions phosphate regulon transcriptional regulatory protein PhoB (TIGR02154; HMM-score: 78.5)Signal transduction Two-component systems phosphate regulon transcriptional regulatory protein PhoB (TIGR02154; HMM-score: 78.5)Regulatory functions DNA interactions heavy metal response regulator (TIGR01387; HMM-score: 72)and 1 moreproteobacterial dedicated sortase system response regulator (TIGR03787; HMM-score: 31.5)
- TheSEED :
- Two-component system response regulator ArlR
- PFAM: HTH (CL0123) Trans_reg_C; Transcriptional regulatory protein, C terminal (PF00486; HMM-score: 104.4)and 1 moreStaph_reg_Sar_Rot; Transcriptional regulator SarA/Rot (PF22381; HMM-score: 13.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.67
- Cytoplasmic Membrane Score: 0.01
- Cellwall Score: 0.15
- Extracellular Score: 0.17
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9774
- Cytoplasmic Membrane Score: 0.0039
- Cell wall & surface Score: 0.0004
- Extracellular Score: 0.0183
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002955
- TAT(Tat/SPI): 0.000151
- LIPO(Sec/SPII): 0.000806
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MTVNGAEIELTKTEYDLLYLLAENKNHVMQREQILNHVWGYNSEVETNVVDVYIRYLRNKLKPYDRDKMIETVRGVGYVIR
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: arlS < SA1247 < SA1248
⊟Regulation[edit | edit source]
- regulator: Fur* (repression) regulon
Fur* (TF) important in Iron homeostasis; RegPrecise
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]