From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1247 [new locus tag: SA_RS07075 ]
  • pan locus tag?: SAUPAN003835000
  • symbol: SA1247
  • pan gene symbol?: arlR
  • synonym:
  • product: truncated ( response regulator ArlR

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA1247 [new locus tag: SA_RS07075 ]
  • symbol: SA1247
  • product: truncated ( response regulator ArlR
  • replicon: chromosome
  • strand: -
  • coordinates: 1423544..1423789
  • length: 246
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    GTGACGGTAAATGGCGCAGAAATTGAATTAACAAAAACAGAGTATGATTTACTATATCTT
    CTAGCTGAAAATAAAAACCATGTTATGCAACGGGAACAAATTTTAAATCATGTATGGGGT
    TATAATAGTGAAGTAGAAACAAATGTCGTAGATGTTTATATAAGATATTTACGAAACAAG
    TTAAAACCATACGATCGTGACAAAATGATTGAAACAGTTCGTGGCGTTGGGTATGTGATA
    CGATGA
    60
    120
    180
    240
    246

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA1247 [new locus tag: SA_RS07075 ]
  • symbol: SA1247
  • description: truncated ( response regulator ArlR
  • length: 81
  • theoretical pI: 6.52603
  • theoretical MW: 9663
  • GRAVY: -0.490123

Function[edit | edit source]

  • TIGRFAM:
    Signal transduction Regulatory functions DNA interactions phosphate regulon transcriptional regulatory protein PhoB (TIGR02154; HMM-score: 78.5)
    Signal transduction Signal transduction Two-component systems phosphate regulon transcriptional regulatory protein PhoB (TIGR02154; HMM-score: 78.5)
    Signal transduction Regulatory functions DNA interactions heavy metal response regulator (TIGR01387; HMM-score: 72)
    and 1 more
    proteobacterial dedicated sortase system response regulator (TIGR03787; HMM-score: 31.5)
  • TheSEED  :
    • Two-component system response regulator ArlR
  • PFAM:
    HTH (CL0123) Trans_reg_C; Transcriptional regulatory protein, C terminal (PF00486; HMM-score: 104.4)
    and 1 more
    Staph_reg_Sar_Rot; Transcriptional regulator SarA/Rot (PF22381; HMM-score: 13.5)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9774
    • Cytoplasmic Membrane Score: 0.0039
    • Cell wall & surface Score: 0.0004
    • Extracellular Score: 0.0183
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.002955
    • TAT(Tat/SPI): 0.000151
    • LIPO(Sec/SPII): 0.000806
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MTVNGAEIELTKTEYDLLYLLAENKNHVMQREQILNHVWGYNSEVETNVVDVYIRYLRNKLKPYDRDKMIETVRGVGYVIR

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator: Fur* (repression) regulon
    Fur*(TF)important in Iron homeostasis; RegPrecise 

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]