Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_RS09635 [old locus tag: NWMN_1716 ]
- pan locus tag?: SAUPAN004585000
- symbol: NWMN_RS09635
- pan gene symbol?: epiA
- synonym:
- product: lantibiotic epidermin
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_RS09635 [old locus tag: NWMN_1716 ]
- symbol: NWMN_RS09635
- product: lantibiotic epidermin
- replicon: chromosome
- strand: -
- coordinates: 1914593..1914736
- length: 144
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGGAAAAAGTTCTTGATTTAGACGTGCAAGTTAAAGCAAACAATAACTCAAATGATTCA
GCAGGTGACGAACGTATTACAAGTCATAGTTTATGTACTCCTGGTTGTGCTAAGACTGGT
AGTTTTAATAGCTTCTGCTGTTAA60
120
144
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_RS09635 [old locus tag: NWMN_1716 ]
- symbol: NWMN_RS09635
- description: lantibiotic epidermin
- length: 47
- theoretical pI: 4.70292
- theoretical MW: 5008.52
- GRAVY: -0.419149
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Toxin production and resistance lantibiotic, gallidermin/nisin family (TIGR03731; HMM-score: 82.7)
- TheSEED: see NWMN_1716
- PFAM: no clan defined Gallidermin; Gallidermin (PF02052; HMM-score: 73.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Extracellular
- Cytoplasmic Score: 0.24
- Cytoplasmic Membrane Score: 0.05
- Cellwall Score: 0.8
- Extracellular Score: 8.91
- Internal Helices: 0
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0.0001
- Cytoplasmic Membrane Score: 0.2822
- Cell wall & surface Score: 0.0038
- Extracellular Score: 0.7139
- LocateP:
- SignalP: Signal peptide SP(Sec/SPI) length 22 aa
- SP(Sec/SPI): 0.672435
- TAT(Tat/SPI): 0.004359
- LIPO(Sec/SPII): 0.015974
- Cleavage Site: CS pos: 22-23. SAG-DE. Pr: 0.0613
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MEKVLDLDVQVKANNNSNDSAGDERITSHSLCTPGCAKTGSFNSFCC
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]