From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1878 [new locus tag: SACOL_RS09635 ]
  • pan locus tag?: SAUPAN004585000
  • symbol: epiA
  • pan gene symbol?: epiA
  • synonym:
  • product: lantibiotic epidermin precursor EpiA

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SACOL1878 [new locus tag: SACOL_RS09635 ]
  • symbol: epiA
  • product: lantibiotic epidermin precursor EpiA
  • replicon: chromosome
  • strand: -
  • coordinates: 1931885..1932028
  • length: 144
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    ATGGAAAAAGTTCTTGATTTAGACGTGCAAGTTAAAGCAAACAATAACTCAAATGATTCA
    GCAGGTGACGAACGTATTACAAGTCATAGTTTATGTACTCCTGGTTGTGCTAAGACTGGT
    AGTTTTAATAGCTTCTGCTGTTAA
    60
    120
    144


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SACOL1878 [new locus tag: SACOL_RS09635 ]
  • symbol: EpiA
  • description: lantibiotic epidermin precursor EpiA
  • length: 47
  • theoretical pI: 4.70292
  • theoretical MW: 5008.52
  • GRAVY: -0.419149

⊟Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Toxin production and resistance lantibiotic, gallidermin/nisin family (TIGR03731; HMM-score: 82.7)
  • TheSEED  :
    • lantibiotic precursor
  • PFAM:
    no clan defined Gallidermin; Gallidermin (PF02052; HMM-score: 73.4)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Extracellular
    • Cytoplasmic Score: 0.24
    • Cytoplasmic Membrane Score: 0.05
    • Cellwall Score: 0.8
    • Extracellular Score: 8.91
    • Internal Helices: 0
  • DeepLocPro: Extracellular
    • Cytoplasmic Score: 0.0001
    • Cytoplasmic Membrane Score: 0.2822
    • Cell wall & surface Score: 0.0038
    • Extracellular Score: 0.7139
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: Signal peptide SP(Sec/SPI) length 22 aa
    • SP(Sec/SPI): 0.672435
    • TAT(Tat/SPI): 0.004359
    • LIPO(Sec/SPII): 0.015974
    • Cleavage Site: CS pos: 22-23. SAG-DE. Pr: 0.0613
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MEKVLDLDVQVKANNNSNDSAGDERITSHSLCTPGCAKTGSFNSFCC

⊟Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]


⊟Relevant publications[edit | edit source]