From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS08325 [old locus tag: NWMN_1478 ]
  • pan locus tag?: SAUPAN004158000
  • symbol: NWMN_RS08325
  • pan gene symbol?: rpsU
  • synonym:
  • product: 30S ribosomal protein S21

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_RS08325 [old locus tag: NWMN_1478 ]
  • symbol: NWMN_RS08325
  • product: 30S ribosomal protein S21
  • replicon: chromosome
  • strand: -
  • coordinates: 1644619..1644795
  • length: 177
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

  • Location: NC_009641 (1644619..1644795) NCBI
  • BioCyc:
  • MicrobesOnline: see NWMN_1478

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    ATGTCTAAAACAGTAGTACGTAAAAATGAATCACTTGAAGATGCGTTACGTAGATTTAAA
    CGTTCAGTTTCTAAAAGTGGAACAATCCAAGAAGTACGTAAACGTGAATTTTACGAAAAA
    CCAAGCGTAAAACGTAAAAAGAAATCAGAAGCTGCACGTAAACGTAAATTCAAATAA
    60
    120
    177

⊟Protein[edit | edit source]

Protein Data Bank: 5ND8
Protein Data Bank: 5ND9

⊟General[edit | edit source]

  • locus tag: NWMN_RS08325 [old locus tag: NWMN_1478 ]
  • symbol: NWMN_RS08325
  • description: 30S ribosomal protein S21
  • length: 58
  • theoretical pI: 11.7454
  • theoretical MW: 6972.13
  • GRAVY: -1.45172

⊟Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein bS21 (TIGR00030; HMM-score: 74.5)
  • TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
  • PFAM:
    no clan defined Ribosomal_S21; Ribosomal protein S21 (PF01165; HMM-score: 77.1)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.017333
    • TAT(Tat/SPI): 0.006243
    • LIPO(Sec/SPII): 0.010111
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MSKTVVRKNESLEDALRRFKRSVSKSGTIQEVRKREFYEKPSVKRKKKSEAARKRKFK

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=NWMN_RS08325&oldid=82453"