From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS08160 [old locus tag: NWMN_1446 ]
  • pan locus tag?: SAUPAN004121000
  • symbol: NWMN_RS08160
  • pan gene symbol?: comGC
  • synonym:
  • product: competence protein ComGC

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_RS08160 [old locus tag: NWMN_1446 ]
  • symbol: NWMN_RS08160
  • product: competence protein ComGC
  • replicon: chromosome
  • strand: -
  • coordinates: 1614748..1615059
  • length: 312
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

  • Location: NC_009641 (1614748..1615059) NCBI
  • BioCyc:
  • MicrobesOnline: see NWMN_1446

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTA
    TTAATCATCAGTTTATTATTAATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCAC
    ATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTAATAGTCAAATTGAAGCGTAT
    GCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
    AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCA
    GTTGCAAATTAG
    60
    120
    180
    240
    300
    312

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: NWMN_RS08160 [old locus tag: NWMN_1446 ]
  • symbol: NWMN_RS08160
  • description: competence protein ComGC
  • length: 103
  • theoretical pI: 8.76209
  • theoretical MW: 11315.3
  • GRAVY: 0.283495

⊟Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Pathogenesis type II secretion system protein G (TIGR01710; HMM-score: 41.8)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type II secretion system protein G (TIGR01710; HMM-score: 41.8)
    and 7 more
    Cell structure Cell envelope Surface structures Verru_Chthon cassette protein D (TIGR02596; HMM-score: 24.9)
    Cellular processes Cellular processes Pathogenesis type II secretion system protein H (TIGR01708; HMM-score: 20.2)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type II secretion system protein H (TIGR01708; HMM-score: 20.2)
    Cell structure Cell envelope Surface structures prepilin-type N-terminal cleavage/methylation domain (TIGR02532; HMM-score: 20.1)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking prepilin-type N-terminal cleavage/methylation domain (TIGR02532; HMM-score: 20.1)
    Cell structure Cell envelope Surface structures Verru_Chthon cassette protein C (TIGR02599; HMM-score: 16.7)
    type II secretion system protein I (TIGR01707; HMM-score: 11.5)
  • TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
  • PFAM:
    no clan defined N_methyl; Prokaryotic N-terminal methylation motif (PF07963; HMM-score: 23.8)
    and 6 more
    SecD-TM1; SecD export protein N-terminal TM region (PF13721; HMM-score: 15)
    HTH (CL0123) Sigma70_r2; Sigma-70 region 2 (PF04542; HMM-score: 14.2)
    no clan defined SHP; Small hydrophobic protein (PF03579; HMM-score: 13.5)
    Ecm33; GPI-anchored cell wall organization protein (PF12454; HMM-score: 11.4)
    Tad-like (CL0496) TadF; Putative tight adherence pilin protein F (PF16964; HMM-score: 10.2)
    no clan defined DUF5383; Family of unknown function (DUF5383) (PF17355; HMM-score: 7.8)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cellwall
    • Cytoplasmic Score: 0.11
    • Cytoplasmic Membrane Score: 0.93
    • Cellwall Score: 8.19
    • Extracellular Score: 0.77
    • Internal Helix: 1
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.25928
    • TAT(Tat/SPI): 0.002582
    • LIPO(Sec/SPII): 0.008511
  • predicted transmembrane helices (TMHMM): 1

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFIKEAQKTCKSGETITISNGEAVAN

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • data available for N315

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=NWMN_RS08160&oldid=81889"