From AureoWiki
Jump to navigation Jump to search
COLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS07510
  • pan locus tag?:
  • symbol: NWMN_RS07510
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_RS07510
  • symbol: NWMN_RS07510
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1467339..1467560
  • length: 222
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_009641 (1467339..1467560) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGAAAAACTATTCGTTTTATCAATTTGTCATGACAGTTCGTGGTCGACACGACGATAAA
    GGTCGTCTAGCAGAAGAGATATTTGACGATCTTGCTTTCCCAAAACACGATGATGATTTT
    AACATACTGTCTGATTATATTGAGACACATGGTGATTTCACATTGCCAATGTCTGTATTT
    GATGATTTATATGAAGAATATACGGAATGGCTAAAATTTTAA
    60
    120
    180
    222

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_RS07510
  • symbol: NWMN_RS07510
  • description: hypothetical protein
  • length: 73
  • theoretical pI: 4.14928
  • theoretical MW: 8869.76
  • GRAVY: -0.617808

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED:
  • PFAM:
    no clan defined YozE_SAM_like; YozE SAM-like fold (PF06855; HMM-score: 80.7)
    and 1 more
    P-loop_NTPase (CL0023) Terminase_6N; Terminase large subunit, T4likevirus-type, N-terminal (PF03237; HMM-score: 12.6)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.7875
    • Cytoplasmic Membrane Score: 0.0068
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.2057
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.011149
    • TAT(Tat/SPI): 0.000218
    • LIPO(Sec/SPII): 0.001612
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 446723694 NCBI
  • RefSeq: WP_000801007 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MKNYSFYQFVMTVRGRHDDKGRLAEEIFDDLAFPKHDDDFNILSDYIETHGDFTLPMSVFDDLYEEYTEWLKF

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator: VraR (activation) regulon
    VraR(TF)response regulator important for resistance against cell-wall targeting antibiotics;  [1] [2]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Makoto Kuroda, Hiroko Kuroda, Taku Oshima, Fumihiko Takeuchi, Hirotada Mori, Keiichi Hiramatsu
    Two-component system VraSR positively modulates the regulation of cell-wall biosynthesis pathway in Staphylococcus aureus.
    Mol Microbiol: 2003, 49(3);807-21
    [PubMed:12864861] [WorldCat.org] [DOI] (P p)
  2. Susan Boyle-Vavra, Shouhui Yin, Dae Sun Jo, Christopher P Montgomery, Robert S Daum
    VraT/YvqF is required for methicillin resistance and activation of the VraSR regulon in Staphylococcus aureus.
    Antimicrob Agents Chemother: 2013, 57(1);83-95
    [PubMed:23070169] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]