From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS06835 [old locus tag: NWMN_1216 ]
  • pan locus tag?: SAUPAN003625000
  • symbol: NWMN_RS06835
  • pan gene symbol?: glnR
  • synonym:
  • product: MerR family transcriptional regulator

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_RS06835 [old locus tag: NWMN_1216 ]
  • symbol: NWMN_RS06835
  • product: MerR family transcriptional regulator
  • replicon: chromosome
  • strand: +
  • coordinates: 1342377..1342745
  • length: 369
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

  • Location: NC_009641 (1342377..1342745) NCBI
  • BioCyc:
  • MicrobesOnline: see NWMN_1216

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGATATCGAATGATGCAATCAGACGAAATATGGCTGTCTTCTCTATGAGTGTAGTAAGT
    AAGTTAACGGATTTAACGCCAAGGCAAATACGTTACTATGAAACACATGAACTCATCAAA
    CCTGAAAGAACAGAAGGTCAAAAACGTCTGTTCTCACTCAATGATTTGGAAAGATTACTA
    GAAATTAAATCATTATTAGAAAAAGGATTTAATATCAAAGGGATTAAACAAATCATTTAT
    GACTCACAAGAGCATTTAACAACAGATGAACAAGAGATAAGAAAAAAGATGATTGTAGAT
    GCCACGCAAAAGCCTATTGGAGAAACTTTGCCAATAAATCGTGGTGATTTATCCCGATTT
    ATTAAATAA
    60
    120
    180
    240
    300
    360
    369


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: NWMN_RS06835 [old locus tag: NWMN_1216 ]
  • symbol: NWMN_RS06835
  • description: MerR family transcriptional regulator
  • length: 122
  • theoretical pI: 9.8101
  • theoretical MW: 14276.5
  • GRAVY: -0.546721

⊟Function[edit | edit source]

  • TIGRFAM:
    Signal transduction Regulatory functions DNA interactions Cu(I)-responsive transcriptional regulator (TIGR02044; HMM-score: 34)
    Cellular processes Cellular processes Detoxification Hg(II)-responsive transcriptional regulator (TIGR02051; HMM-score: 33.2)
    Signal transduction Regulatory functions DNA interactions Hg(II)-responsive transcriptional regulator (TIGR02051; HMM-score: 33.2)
    Signal transduction Regulatory functions DNA interactions Zn(II)-responsive transcriptional regulator (TIGR02043; HMM-score: 33)
    and 4 more
    Signal transduction Regulatory functions DNA interactions Cd(II)/Pb(II)-responsive transcriptional regulator (TIGR02047; HMM-score: 23.9)
    Cellular processes Cellular processes Detoxification redox-sensitive transcriptional activator SoxR (TIGR01950; HMM-score: 19.4)
    Signal transduction Regulatory functions DNA interactions redox-sensitive transcriptional activator SoxR (TIGR01950; HMM-score: 19.4)
    Genetic information processing Mobile and extrachromosomal element functions Plasmid functions plasmid partitioning protein RepA (TIGR03453; HMM-score: 12.2)
  • TheSEED: see NWMN_1216
  • PFAM:
    HTH (CL0123) MerR_1; MerR HTH family regulatory protein (PF13411; HMM-score: 70)
    and 4 more
    MerR; MerR family regulatory protein (PF00376; HMM-score: 43)
    no clan defined PDGF_N; Platelet-derived growth factor, N terminal region (PF04692; HMM-score: 15.2)
    HTH (CL0123) MerR_2; MerR HTH family regulatory protein (PF13591; HMM-score: 14.5)
    KNTase_C (CL0291) DUF5667; Domain of unknown function (DUF5667) (PF18915; HMM-score: 13.8)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • genes regulated by GlnR, TF important in Nitrogen assimilation: see NWMN_1216

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9375
    • Cytoplasmic Membrane Score: 0.0423
    • Cell wall & surface Score: 0.0006
    • Extracellular Score: 0.0196
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.005097
    • TAT(Tat/SPI): 0.004677
    • LIPO(Sec/SPII): 0.003218
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MISNDAIRRNMAVFSMSVVSKLTDLTPRQIRYYETHELIKPERTEGQKRLFSLNDLERLLEIKSLLEKGFNIKGIKQIIYDSQEHLTTDEQEIRKKMIVDATQKPIGETLPINRGDLSRFIK

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]


⊟Relevant publications[edit | edit source]