Jump to navigation
		Jump to search
		
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_RS04845 [old locus tag: NWMN_0862 ]
- pan locus tag?: SAUPAN003149000
- symbol: NWMN_RS04845
- pan gene symbol?: opp4D
- synonym:
- product: peptide ABC transporter ATP-binding protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_RS04845 [old locus tag: NWMN_0862 ]
- symbol: NWMN_RS04845
- product: peptide ABC transporter ATP-binding protein
- replicon: chromosome
- strand: +
- coordinates: 958473..959459
- length: 987
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
 61
 121
 181
 241
 301
 361
 421
 481
 541
 601
 661
 721
 781
 841
 901
 961ATGAATAATGTATTGTTAGAGGTTAAAGATTTAGAAACATCATTAAAAATAAATAATGAA
 TGGTTAGCAACTGTTGAAAATATTTCTTTTGAATTATCTAAAGGAGAAGTTTTGGGTATA
 GTAGGGGAATCTGGTTGCGGTAAGTCCATATTAAGTAAGTCAATTATTAAATTATTACCA
 GAAAAGATATCTAAACTAAGTAATGGAGAAGTTATATTTGATGGTAAACGAATCGATACG
 CTCAATGAGAAGCAATTGCTAGATATTCGAGGAAATGATATTGCTATGATTTTTCAAGAA
 CCTATGACTGCTTTAAATCCTGTATTTACCATAAAAAATCAACTTGTGGAATCTATAAAA
 TCACATAAAAAAATTTCTAAAAAAGAAGCAAATAAATTAGCAAAAGATTTACTAAAAAAA
 GTTGGAATTGCTAGACAAGATGAAATATTAAATAGCTATCCTCATCAATTATCTGGTGGT
 ATGAGACAAAGAGTAATGATTGCAATGGCCATTTCATGTTCTCCTAAATTATTAATTGCT
 GATGAACCTACAACAGCATTGGATGTCACGATTCAAGCGCAAATATTAGACTTATTAAAA
 GAATTGCAAAAGGAAACGCAAATGGCAATTATGATGATTACACATGATTTGAGTGTAGTT
 GCTGAGTTTTGCGATAAAGTCTTAGTTATGTATGCAGGTCAAATTGTAGAATTTGGAGGC
 ATAAAAGAAATACTACACAATCCGAAACATCCTTATACCCAAAAATTATTATCAACAATT
 CCAAAACTTAAAGAAGAGCAGAAACGACTTGAAACGATAGAAGGAATTGTGCCATCAATC
 CAAGCATTTCACGTTAATAAGTGCAGATTTGCAAATAGATGTAACAAAAAACTGGATATT
 TGTAATAATCAATCTCCTAAAATGCATGTTTGTGAAGATGTCATTGTACGTTGTCATTTG
 TACAAAAATGAATATAAGGAGATATAA60
 120
 180
 240
 300
 360
 420
 480
 540
 600
 660
 720
 780
 840
 900
 960
 987
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_RS04845 [old locus tag: NWMN_0862 ]
- symbol: NWMN_RS04845
- description: peptide ABC transporter ATP-binding protein
- length: 328
- theoretical pI: 8.38832
- theoretical MW: 37003.3
- GRAVY: -0.156098
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 282.2)and 73 moreTransport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 192.4)Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 171.5)Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 154.5)D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 153.8)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 152)Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 143.5)Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 142.6)Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 141.7)ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 141.3)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 140.5)ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 130)Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 128.4)Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 128.4)Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 125.1)Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 123.9)Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 120.5)Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 120.2)Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 119.4)Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 112.7)Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 112.7)2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 112.2)Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 110.2)Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 108.5)Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 107.2)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 100.4)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 100.4)proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 100)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 97.8)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 96.9)Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 96.9)Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 93.1)Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 92.7)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 92.4)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 92.4)Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 91.9)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 91.2)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 90.6)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 90)Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 90)Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 89.6)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 89.6)Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 89.2)thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 89)Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 86.3)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 86.2)Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 86.2)phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 85.5)Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 85)Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 85)Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 81)Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 81)Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 81)ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 80.4)Transport and binding proteins Amino acids, peptides and amines oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain (TIGR01727; HMM-score: 79)gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 76.2)Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 73.8)Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 72)Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 72)lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 70.3)thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 69.4)Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 58.2)Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 58.2)ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 55.7)Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 46.3)Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 45.6)Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 39.4)Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 39.2)Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 38)Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 35.9)Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 35.9)DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 29.6)Central intermediary metabolism Sulfur metabolism adenylyl-sulfate kinase (TIGR00455; EC 2.7.1.25; HMM-score: 13.1)DNA metabolism DNA replication, recombination, and repair DNA repair protein RecN (TIGR00634; HMM-score: 12.9)
- TheSEED: see NWMN_0862
- PFAM: P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 110.5)and 17 moreno clan defined oligo_HPY; Oligopeptide/dipeptide transporter, C-terminal region (PF08352; HMM-score: 72.8)P-loop_NTPase (CL0023) SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 40.2)AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 24.9)NPHP3_N; Nephrocystin 3, N-terminal (PF24883; HMM-score: 20.8)RNA_helicase; RNA helicase (PF00910; HMM-score: 20.5)AAA_22; AAA domain (PF13401; HMM-score: 19.8)TniB; Bacterial TniB protein (PF05621; HMM-score: 16.2)NB-ARC; NB-ARC domain (PF00931; HMM-score: 15.8)Mg_chelatase; Magnesium chelatase, subunit ChlI (PF01078; HMM-score: 14.7)RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 14.5)AAA_23; AAA domain (PF13476; HMM-score: 14.3)ATP-synt_ab; ATP synthase alpha/beta family, nucleotide-binding domain (PF00006; HMM-score: 13.9)ATPase_2; ATPase domain predominantly from Archaea (PF01637; HMM-score: 13.6)AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 12.4)NACHT; NACHT domain (PF05729; HMM-score: 12)nSTAND3; Novel STAND NTPase 3 (PF20720; HMM-score: 11.6)DUF87; Helicase HerA, central domain (PF01935; HMM-score: 11.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane- Cytoplasmic Score: 1.05
- Cytoplasmic Membrane Score: 8.78
- Cellwall Score: 0.08
- Extracellular Score: 0.09
- Internal Helices: 0
 
- DeepLocPro: Cytoplasmic Membrane- Cytoplasmic Score: 0.1799
- Cytoplasmic Membrane Score: 0.6525
- Cell wall & surface Score: 0.0004
- Extracellular Score: 0.1672
 
- LocateP:
- SignalP: no predicted signal peptide- SP(Sec/SPI): 0.008538
- TAT(Tat/SPI): 0.000313
- LIPO(Sec/SPII): 0.001036
 
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MNNVLLEVKDLETSLKINNEWLATVENISFELSKGEVLGIVGESGCGKSILSKSIIKLLPEKISKLSNGEVIFDGKRIDTLNEKQLLDIRGNDIAMIFQEPMTALNPVFTIKNQLVESIKSHKKISKKEANKLAKDLLKKVGIARQDEILNSYPHQLSGGMRQRVMIAMAISCSPKLLIADEPTTALDVTIQAQILDLLKELQKETQMAIMMITHDLSVVAEFCDKVLVMYAGQIVEFGGIKEILHNPKHPYTQKLLSTIPKLKEEQKRLETIEGIVPSIQAFHVNKCRFANRCNKKLDICNNQSPKMHVCEDVIVRCHLYKNEYKEI
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: CodY see NWMN_0862
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]