Jump to navigation
Jump to search
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_1484 [new locus tag: NWMN_RS08355 ]
- pan locus tag?: SAUPAN004164000
- symbol: grpE
- pan gene symbol?: grpE
- synonym:
- product: heat shock protein GrpE
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_1484 [new locus tag: NWMN_RS08355 ]
- symbol: grpE
- product: heat shock protein GrpE
- replicon: chromosome
- strand: -
- coordinates: 1651313..1651939
- length: 627
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5331875 NCBI
- RefSeq: YP_001332518 NCBI
- BioCyc:
- MicrobesOnline: 3707036 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601ATGACAAATAAAGACGAATCAGTTGAAAAAAACACTGAATCAACAGTTGAAGAAACAAAC
GTCAAACAAAATATTGATGATTCAGTTGAACAAGCTGAAGAAAGTAAAGGTCATTTACAA
GATGAAGCAATAGAAGAAACGTCTGACGAGAATGTTATTGAAGAAATAGATCCAAAAGAT
CAAAAAATTAATGAACTTCAACAATTAGCAGATGAAAACGAAGAGAAATATTTAAGGCTC
TACGCTGAGTTTGAAAATTATAAGCGTAGAATTCAAAAAGAAAATGAAATAAACAAAACA
TATCAAGCACAACGTGTGTTAACAGATATTTTACCAGCAATAGACAATATAGAACGTGCA
CTTCAAATTGAAGGTGATGATGAGACTTTTAAATCTCTTCAAAAAGGTGTACAAATGGTG
CATGAAAGTTTGATTAACGCACTAAAAGATAATGGTCTTGAAGTTATTAAAACTGAAGGT
GAAGCATTTGATCCAAATATTCACCAAGCTGTAGTTCAAGATGATAACCCTGATTTTGAA
TCTGGCGAAATCACTCAAGAACTACAAAAAGGATACAAGCTTAAAGATAGAGTATTAAGA
CCATCAATGGTCAAAGTAAACCAATAA60
120
180
240
300
360
420
480
540
600
627
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_1484 [new locus tag: NWMN_RS08355 ]
- symbol: GrpE
- description: heat shock protein GrpE
- length: 208
- theoretical pI: 4.14169
- theoretical MW: 24008.2
- GRAVY: -1.03413
⊟Function[edit | edit source]
- TIGRFAM: chain length determinant protein EpsF (TIGR03017; HMM-score: 9.6)
- TheSEED :
- Heat shock protein GrpE
and 1 more - PFAM: no clan defined GrpE; GrpE (PF01025; HMM-score: 164.7)and 2 moreDUF6827; Domain of unknown function (DUF6827) (PF20715; HMM-score: 10.3)DUF5856; Family of unknown function (DUF5856) (PF19174; HMM-score: 8.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.996
- Cytoplasmic Membrane Score: 0.0007
- Cell wall & surface Score: 0.0003
- Extracellular Score: 0.003
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.00891
- TAT(Tat/SPI): 0.00396
- LIPO(Sec/SPII): 0.002874
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MTNKDESVEKNTESTVEETNVKQNIDDSVEQAEESKGHLQDEAIEETSDENVIEEIDPKDQKINELQQLADENEEKYLRLYAEFENYKRRIQKENEINKTYQAQRVLTDILPAIDNIERALQIEGDDETFKSLQKGVQMVHESLINALKDNGLEVIKTEGEAFDPNIHQAVVQDDNPDFESGEITQELQKGYKLKDRVLRPSMVKVNQ
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: HrcA (repression) regulon
HrcA (TF) important in Heat shock response; RegPrecise transcription unit transferred from N315 data RegPrecise
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Arnaud Chastanet, Juliette Fert, Tarek Msadek
Comparative genomics reveal novel heat shock regulatory mechanisms in Staphylococcus aureus and other Gram-positive bacteria.
Mol Microbiol: 2003, 47(4);1061-73
[PubMed:12581359] [WorldCat.org] [DOI] (P p)