Jump to navigation
		Jump to search
		
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_1444 [new locus tag: NWMN_RS08150 ]
- pan locus tag?: SAUPAN004119000
- symbol: NWMN_1444
- pan gene symbol?: comGE
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_1444 [new locus tag: NWMN_RS08150 ]
- symbol: NWMN_1444
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1614038..1614337
- length: 300
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5330858 NCBI
- RefSeq: YP_001332478 NCBI
- BioCyc:
- MicrobesOnline: 3706996 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
 61
 121
 181
 241ATGAAAAGCTATAAGTGTAAAGGTTCATTCTTAATAGATAGTATGGCTGGATTTTTGCTA
 ATTGGATTGATTACATTACTATTGATACCAATGATGAATCAAATGCAAGCGAGTATAAAC
 CATAAACTACAAACAATTGATGCTTCTAAAGTAATTTTGACGACTGTATCTAAAATTAAT
 AAAGAAGAACTTAAGAAGGGGGTAACTATAGGGAAGTATGATATTAAGCAAAGTGACCAA
 CAAATTTGTGCTATTTCAAAAAATACCACTTCTTATCAAAAGACATGTATACAGTATTAA60
 120
 180
 240
 300
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_1444 [new locus tag: NWMN_RS08150 ]
- symbol: NWMN_1444
- description: hypothetical protein
- length: 99
- theoretical pI: 9.92887
- theoretical MW: 11093.2
- GRAVY: 0.0040404
⊟Function[edit | edit source]
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helix: 1
 
- DeepLocPro: Cytoplasmic Membrane- Cytoplasmic Score: 0.0015
- Cytoplasmic Membrane Score: 0.9031
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0952
 
- LocateP: N-terminally anchored (No CS) - Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: 0
- N-terminally Anchored Score: 7
- Predicted Cleavage Site: No CleavageSite
 
- SignalP: Signal peptide SP(Sec/SPI) length 37 aa- SP(Sec/SPI): 0.671681
- TAT(Tat/SPI): 0.013964
- LIPO(Sec/SPII): 0.004951
- Cleavage Site: CS pos: 37-38. MQA-SI. Pr: 0.6346
 
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKSYKCKGSFLIDSMAGFLLIGLITLLLIPMMNQMQASINHKLQTIDASKVILTTVSKINKEELKKGVTIGKYDIKQSDQQICAISKNTTSYQKTCIQY
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]