From AureoWiki
Jump to navigation Jump to search

NCBI: 06-JUL-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1444 [new locus tag: NWMN_RS08150 ]
  • pan locus tag?: SAUPAN004119000
  • symbol: NWMN_1444
  • pan gene symbol?: comGE
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_1444 [new locus tag: NWMN_RS08150 ]
  • symbol: NWMN_1444
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1614038..1614337
  • length: 300
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGAAAAGCTATAAGTGTAAAGGTTCATTCTTAATAGATAGTATGGCTGGATTTTTGCTA
    ATTGGATTGATTACATTACTATTGATACCAATGATGAATCAAATGCAAGCGAGTATAAAC
    CATAAACTACAAACAATTGATGCTTCTAAAGTAATTTTGACGACTGTATCTAAAATTAAT
    AAAGAAGAACTTAAGAAGGGGGTAACTATAGGGAAGTATGATATTAAGCAAAGTGACCAA
    CAAATTTGTGCTATTTCAAAAAATACCACTTCTTATCAAAAGACATGTATACAGTATTAA
    60
    120
    180
    240
    300

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_1444 [new locus tag: NWMN_RS08150 ]
  • symbol: NWMN_1444
  • description: hypothetical protein
  • length: 99
  • theoretical pI: 9.92887
  • theoretical MW: 11093.2
  • GRAVY: 0.0040404

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • Late competence protein ComGE, FIG018915
    DNA Metabolism DNA uptake, competence Late competence  Late competence protein ComGE, FIG018915
  • PFAM:
    no clan defined SecM_small; secA translation cis-regulator SecM, small type (PF10818; HMM-score: 15.7)
    Radical_SAM_N; Radical SAM N-terminal (PF08497; HMM-score: 13.5)
    Flp_Fap; Flp/Fap pilin component (PF04964; HMM-score: 12.7)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helix: 1
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0015
    • Cytoplasmic Membrane Score: 0.9031
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.0952
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: 0
    • N-terminally Anchored Score: 7
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: Signal peptide SP(Sec/SPI) length 37 aa
    • SP(Sec/SPI): 0.671681
    • TAT(Tat/SPI): 0.013964
    • LIPO(Sec/SPII): 0.004951
    • Cleavage Site: CS pos: 37-38. MQA-SI. Pr: 0.6346
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKSYKCKGSFLIDSMAGFLLIGLITLLLIPMMNQMQASINHKLQTIDASKVILTTVSKINKEELKKGVTIGKYDIKQSDQQICAISKNTTSYQKTCIQY

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]