Jump to navigation
Jump to search
FunGene: 08-OCT-2024
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: JSNZ_002032
- pan locus tag?: SAUPAN005342000
- symbol: acpS
- pan gene symbol?: acpS
- synonym:
- product: holo-ACP synthase
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: JSNZ_002032
- symbol: acpS
- product: holo-ACP synthase
- replicon: chromosome
- strand: -
- coordinates: 2046347..2046706
- length: 360
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq:
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGATACATGGAATTGGTGTAGATTTAATCGAAATCGATCGAATACAATTGTTATATAGT
AAGCAACCAAAATTGGTTGAGCGGATTTTAACTAAAAATGAACAGCACAAATTCAACAAT
TTCACACATGAGCAACGTAAAATTGAATTTTTAGCTGGCAGGTTTGCTACAAAAGAAGCG
TTCAGTAAAGCATTAGGCACAGGCTTAGGAAAACATGTAGCTTTTAACGATATAGACTGT
TACAACGACGAACTTGGCAAACCAAAGATTGATTACGAAGGGTTTATCGTACATGTTAGT
ATCTCACACACTGAGCATTATGCGATGAGCCAAGTTGTTTTAGAAAAGTCAGCATTTTAA60
120
180
240
300
360
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: JSNZ_002032
- symbol: AcpS
- description: holo-ACP synthase
- length: 119
- theoretical pI: 7.2338
- theoretical MW: 13647.5
- GRAVY: -0.302521
⊟Function[edit | edit source]
- reaction: EC 2.7.8.7? ExPASyHolo-[acyl-carrier-protein] synthase CoA-(4'-phosphopantetheine) + apo-[acyl-carrier-protein] = adenosine 3',5'-bisphosphate + holo-[acyl-carrier-protein]
- TIGRFAM: Fatty acid and phospholipid metabolism Biosynthesis holo-[acyl-carrier-protein] synthase (TIGR00516; EC 2.7.8.7; HMM-score: 114.8)Protein fate Protein modification and repair phosphopantetheine--protein transferase domain (TIGR00556; HMM-score: 94.2)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: 4PPT (CL0670) ACPS; 4'-phosphopantetheinyl transferase superfamily (PF01648; HMM-score: 67.4)and 2 more4PPT_N; 4'-phosphopantetheinyl transferase N-terminal domain (PF17837; HMM-score: 26.3)AASDHPPT_N; 4'-phosphopantetheinyl transferase, N-terminal (PF22624; HMM-score: 15.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9932
- Cytoplasmic Membrane Score: 0.0031
- Cell wall & surface Score: 0.0011
- Extracellular Score: 0.0025
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003604
- TAT(Tat/SPI): 0.001248
- LIPO(Sec/SPII): 0.001269
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq:
- UniProt:
⊟Protein sequence[edit | edit source]
- MIHGIGVDLIEIDRIQLLYSKQPKLVERILTKNEQHKFNNFTHEQRKIEFLAGRFATKEAFSKALGTGLGKHVAFNDIDCYNDELGKPKIDYEGFIVHVSISHTEHYAMSQVVLEKSAF
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- Operon-mapper [1] : alr < acpS < JSNZ_002033 < JSNZ_002034 < JSNZ_002035
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p)