From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2061 [new locus tag: SACOL_RS10790 ]
  • pan locus tag?: SAUPAN005342000
  • symbol: acpS
  • pan gene symbol?: acpS
  • synonym:
  • product: 4'-phosphopantetheinyl transferase

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL2061 [new locus tag: SACOL_RS10790 ]
  • symbol: acpS
  • product: 4'-phosphopantetheinyl transferase
  • replicon: chromosome
  • strand: -
  • coordinates: 2126043..2126402
  • length: 360
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGATACATGGAATTGGTGTAGATTTAATCGAAATCGATCGAATACAAGCGTTATATAGT
    AAGCAACCAAAATTGGTTGAGCGGATTTTAACTAAAAATGAACAGCACAAATTCAACAAT
    TTCACACATGAGCAACGTAAAATTGAATTTTTAGCTGGCAGGTTTGCTACAAAAGAAGCG
    TTCAGTAAAGCATTAGGCACAGGCTTAGGAAAACATGTAGCTTTTAACGATATAGACTGT
    TACAACGACGAACTTGGCAAACCAAAGATTGATTACGAAGGGTTTATCGTACATGTTAGT
    ATCTCACACACTGAGCATTATGCGATGAGCCAAGTTGTTTTAGAAAAGTCAGCATTTTAA
    60
    120
    180
    240
    300
    360

Protein[edit | edit source]

Protein Data Bank: 4DXE
Protein Data Bank: 4JM7
Protein Data Bank: 5CXD

General[edit | edit source]

  • locus tag: SACOL2061 [new locus tag: SACOL_RS10790 ]
  • symbol: AcpS
  • description: 4'-phosphopantetheinyl transferase
  • length: 119
  • theoretical pI: 7.2338
  • theoretical MW: 13605.5
  • GRAVY: -0.319328

Function[edit | edit source]

  • reaction:
    EC 2.7.8.7?  ExPASy
    Holo-[acyl-carrier-protein] synthase CoA-(4'-phosphopantetheine) + apo-[acyl-carrier-protein] = adenosine 3',5'-bisphosphate + holo-[acyl-carrier-protein]
  • TIGRFAM:
    Metabolism Fatty acid and phospholipid metabolism Biosynthesis holo-[acyl-carrier-protein] synthase (TIGR00516; EC 2.7.8.7; HMM-score: 116.8)
    Genetic information processing Protein fate Protein modification and repair phosphopantetheine--protein transferase domain (TIGR00556; HMM-score: 94.6)
  • TheSEED  :
    • Holo-[acyl-carrier protein] synthase (EC 2.7.8.7)
    Fatty Acids, Lipids, and Isoprenoids Fatty acids Fatty Acid Biosynthesis FASII  Holo-[acyl-carrier protein] synthase (EC 2.7.8.7)
  • PFAM:
    no clan defined ACPS; 4'-phosphopantetheinyl transferase superfamily (PF01648; HMM-score: 67.4)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors: Mg2+
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.005087
    • TAT(Tat/SPI): 0.001297
    • LIPO(Sec/SPII): 0.001368
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MIHGIGVDLIEIDRIQALYSKQPKLVERILTKNEQHKFNNFTHEQRKIEFLAGRFATKEAFSKALGTGLGKHVAFNDIDCYNDELGKPKIDYEGFIVHVSISHTEHYAMSQVVLEKSAF

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Cytoplasmic [1] [2]
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]