From AureoWiki
Jump to navigation Jump to search

FunGene: 08-OCT-2024

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: JSNZ_001596
  • pan locus tag?: SAUPAN004203000
  • symbol: JSNZ_001596
  • pan gene symbol?:
  • synonym:
  • product: acetyl-CoA carboxylase biotin carboxyl carrier protein subunit

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: JSNZ_001596
  • symbol: JSNZ_001596
  • product: acetyl-CoA carboxylase biotin carboxyl carrier protein subunit
  • replicon: chromosome
  • strand: -
  • coordinates: 1631579..1632028
  • length: 450
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq:
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGAATATTGAAAAAATCGAACAAATAATCAAATTAGTGAAGGAAAATGATGTTAAGAAA
    TTTAAATATAAAAATTTTGAAGATGAAATAGAAATTGACTTCACTGACTCGAATCATTTG
    GCTGCACACAGTAATCAATCAAATCAAAGTATGAACAATAATGATTTGACAGCTTCAAAA
    GCGAATGATAACTCCGATGTTTCGACAAATGATTATCATGACATTAAATCACCAATGGTA
    GGTACATTCTTTTTACAAGATAGTAAAGAATTAACTGAACCAATTGTGAATGTCGGTGAC
    AAAGTTAACAAGGGAGATATTATAGGATATGTTGAAGCGATGAAAGTATTAAACGAGGTA
    ACAACAGATGTTGCTGGAGAAATTACTGAAATAGTAGCTGATCATGGCACAAATGTTGAA
    TACGACCAAGTTTTGGTACGTATTAAGTAA
    60
    120
    180
    240
    300
    360
    420
    450

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: JSNZ_001596
  • symbol: JSNZ_001596
  • description: acetyl-CoA carboxylase biotin carboxyl carrier protein subunit
  • length: 149
  • theoretical pI: 4.33078
  • theoretical MW: 16779.5
  • GRAVY: -0.573154

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Fatty acid and phospholipid metabolism Biosynthesis acetyl-CoA carboxylase, biotin carboxyl carrier protein (TIGR00531; HMM-score: 110.9)
    and 14 more
    Metabolism Central intermediary metabolism Nitrogen metabolism urea carboxylase (TIGR02712; EC 6.3.4.6; HMM-score: 35.5)
    Metabolism Transport and binding proteins Cations and iron carrying compounds oxaloacetate decarboxylase alpha subunit (TIGR01108; EC 4.1.1.3; HMM-score: 34.2)
    Metabolism Energy metabolism Other oxaloacetate decarboxylase alpha subunit (TIGR01108; EC 4.1.1.3; HMM-score: 34.2)
    Metabolism Energy metabolism Glycolysis/gluconeogenesis pyruvate carboxylase (TIGR01235; EC 6.4.1.1; HMM-score: 25.2)
    Metabolism Energy metabolism Pyruvate dehydrogenase dihydrolipoyllysine-residue acetyltransferase (TIGR01348; EC 2.3.1.12; HMM-score: 24.9)
    Metabolism Energy metabolism TCA cycle dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase (succinyl-transferring) complex (TIGR01347; EC 2.3.1.61; HMM-score: 23.6)
    2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase (TIGR02927; EC 2.3.1.61; HMM-score: 18.8)
    Metabolism Energy metabolism ATP-proton motive force interconversion ATP synthase archaeal, A subunit (TIGR01043; EC 3.6.3.14; HMM-score: 17.3)
    selenium-dependent molybdenum hydroxylase system protein, YqeB family (TIGR03309; HMM-score: 16.8)
    Metabolism Energy metabolism Electron transport electron transport complex, RnfABCDGE type, C subunit (TIGR01945; HMM-score: 15.9)
    Metabolism Energy metabolism Amino acids and amines glycine cleavage system H protein (TIGR00527; HMM-score: 15.2)
    proline reductase-associated electron transfer protein PrdC (TIGR04481; HMM-score: 14.2)
    Metabolism Transport and binding proteins Unknown substrate efflux transporter, RND family, MFP subunit (TIGR01730; HMM-score: 12.9)
    Metabolism Energy metabolism Pyruvate dehydrogenase pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase (TIGR01349; EC 2.3.1.12; HMM-score: 11.7)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    Hybrid (CL0105) Biotin_lipoyl; Biotin-requiring enzyme (PF00364; HMM-score: 67.3)
    and 6 more
    RnfC_N; RnfC Barrel sandwich hybrid domain (PF13375; HMM-score: 25.6)
    ATP-synt_ab_Xtn; ATPsynthase alpha/beta subunit barrel-sandwich domain (PF16886; HMM-score: 21.7)
    GCV_H; Glycine cleavage H-protein (PF01597; HMM-score: 20.7)
    Biotin_lipoyl_2; Biotin-lipoyl like (PF13533; HMM-score: 20.4)
    BET (CL0665) BET; Bromodomain extra-terminal - transcription regulation (PF17035; HMM-score: 15)
    Hybrid (CL0105) Peptidase_M23; Peptidase family M23 (PF01551; HMM-score: 13.3)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9921
    • Cytoplasmic Membrane Score: 0.0004
    • Cell wall & surface Score: 0.0005
    • Extracellular Score: 0.0069
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.022632
    • TAT(Tat/SPI): 0.001198
    • LIPO(Sec/SPII): 0.00169
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq:
  • UniProt:

Protein sequence[edit | edit source]

  • MNIEKIEQIIKLVKENDVKKFKYKNFEDEIEIDFTDSNHLAAHSNQSNQSMNNNDLTASKANDNSDVSTNDYHDIKSPMVGTFFLQDSKELTEPIVNVGDKVNKGDIIGYVEAMKVLNEVTTDVAGEITEIVADHGTNVEYDQVLVRIK

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator: CcpA regulon
    CcpA(TF)important in Carbon catabolism;  regulation predicted or transferred from N315 and NCTC 8325  [2]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
    Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
    Bioinformatics: 2018, 34(23);4118-4120
    [PubMed:29931111] [WorldCat.org] [DOI] (I p)
  2. Hannes Wolfgramm, Larissa Milena Busch, Jöran Tebben, Henry Mehlan, Lisa Hagenau, Thomas Sura, Tilly Hoffmüller, Elisa Bludau, Manuela Gesell Salazar, Alexander Reder, Stephan Michalik, Leif Steil, Kristin Surmann, Ulrike Mäder, Silva Holtfreter, Uwe Völker
    Integrated genomic and proteomic analysis of the mouse-adapted Staphylococcus aureus strain JSNZ.
    Curr Res Microb Sci: 2025, 9;100489
    [PubMed:41146725] [WorldCat.org] [DOI] (I e)

Relevant publications[edit | edit source]