Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_001596 [new locus tag: EGJ38_RS07970 ]
- pan locus tag?: SAUPAN004203000
- symbol: EGJ38_001596
- pan gene symbol?: —
- synonym: JSNZ_001596
- product: acetyl-CoA carboxylase biotin carboxyl carrier protein subunit
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_001596 [new locus tag: EGJ38_RS07970 ]
- symbol: EGJ38_001596
- product: acetyl-CoA carboxylase biotin carboxyl carrier protein subunit
- replicon: chromosome
- strand: -
- coordinates: 1631579..1632028
- length: 450
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2423553 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGAATATTGAAAAAATCGAACAAATAATCAAATTAGTGAAGGAAAATGATGTTAAGAAA
TTTAAATATAAAAATTTTGAAGATGAAATAGAAATTGACTTCACTGACTCGAATCATTTG
GCTGCACACAGTAATCAATCAAATCAAAGTATGAACAATAATGATTTGACAGCTTCAAAA
GCGAATGATAACTCCGATGTTTCGACAAATGATTATCATGACATTAAATCACCAATGGTA
GGTACATTCTTTTTACAAGATAGTAAAGAATTAACTGAACCAATTGTGAATGTCGGTGAC
AAAGTTAACAAGGGAGATATTATAGGATATGTTGAAGCGATGAAAGTATTAAACGAGGTA
ACAACAGATGTTGCTGGAGAAATTACTGAAATAGTAGCTGATCATGGCACAAATGTTGAA
TACGACCAAGTTTTGGTACGTATTAAGTAA60
120
180
240
300
360
420
450
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_001596 [new locus tag: EGJ38_RS07970 ]
- symbol: EGJ38_001596
- description: acetyl-CoA carboxylase biotin carboxyl carrier protein subunit
- length: 149
- theoretical pI: 4.33078
- theoretical MW: 16779.5
- GRAVY: -0.573154
⊟Function[edit | edit source]
- TIGRFAM: Fatty acid and phospholipid metabolism Biosynthesis acetyl-CoA carboxylase, biotin carboxyl carrier protein (TIGR00531; HMM-score: 110.9)and 14 moreCentral intermediary metabolism Nitrogen metabolism urea carboxylase (TIGR02712; EC 6.3.4.6; HMM-score: 35.5)Transport and binding proteins Cations and iron carrying compounds oxaloacetate decarboxylase alpha subunit (TIGR01108; EC 4.1.1.3; HMM-score: 34.2)Energy metabolism Other oxaloacetate decarboxylase alpha subunit (TIGR01108; EC 4.1.1.3; HMM-score: 34.2)Energy metabolism Glycolysis/gluconeogenesis pyruvate carboxylase (TIGR01235; EC 6.4.1.1; HMM-score: 25.2)Energy metabolism Pyruvate dehydrogenase dihydrolipoyllysine-residue acetyltransferase (TIGR01348; EC 2.3.1.12; HMM-score: 24.9)Energy metabolism TCA cycle dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase (succinyl-transferring) complex (TIGR01347; EC 2.3.1.61; HMM-score: 23.6)2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase (TIGR02927; EC 2.3.1.61; HMM-score: 18.8)Energy metabolism ATP-proton motive force interconversion ATP synthase archaeal, A subunit (TIGR01043; EC 3.6.3.14; HMM-score: 17.3)selenium-dependent molybdenum hydroxylase system protein, YqeB family (TIGR03309; HMM-score: 16.8)Energy metabolism Electron transport electron transport complex, RnfABCDGE type, C subunit (TIGR01945; HMM-score: 15.9)Energy metabolism Amino acids and amines glycine cleavage system H protein (TIGR00527; HMM-score: 15.2)proline reductase-associated electron transfer protein PrdC (TIGR04481; HMM-score: 14.2)Transport and binding proteins Unknown substrate efflux transporter, RND family, MFP subunit (TIGR01730; HMM-score: 12.9)Energy metabolism Pyruvate dehydrogenase pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase (TIGR01349; EC 2.3.1.12; HMM-score: 11.7)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: Hybrid (CL0105) Biotin_lipoyl; Biotin-requiring enzyme (PF00364; HMM-score: 67.3)and 6 moreRnfC_N; RnfC Barrel sandwich hybrid domain (PF13375; HMM-score: 25.6)ATP-synt_ab_Xtn; ATPsynthase alpha/beta subunit barrel-sandwich domain (PF16886; HMM-score: 21.7)GCV_H; Glycine cleavage H-protein (PF01597; HMM-score: 20.7)Biotin_lipoyl_2; Biotin-lipoyl like (PF13533; HMM-score: 20.4)BET (CL0665) BET; Bromodomain extra-terminal - transcription regulation (PF17035; HMM-score: 15)Hybrid (CL0105) Peptidase_M23; Peptidase family M23 (PF01551; HMM-score: 13.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9921
- Cytoplasmic Membrane Score: 0.0004
- Cell wall & surface Score: 0.0005
- Extracellular Score: 0.0069
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.022632
- TAT(Tat/SPI): 0.001198
- LIPO(Sec/SPII): 0.00169
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2423553 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MNIEKIEQIIKLVKENDVKKFKYKNFEDEIEIDFTDSNHLAAHSNQSNQSMNNNDLTASKANDNSDVSTNDYHDIKSPMVGTFFLQDSKELTEPIVNVGDKVNKGDIIGYVEAMKVLNEVTTDVAGEITEIVADHGTNVEYDQVLVRIK
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- Operon-mapper [1] : EGJ38_001593 < pxpA < EGJ38_001595 < EGJ38_001596 < EGJ38_001597 < pxpB
⊟Regulation[edit | edit source]
- regulator: CcpA/JSNZ_001724 regulon
CcpA/JSNZ_001724 (TF) important in Carbon catabolism; regulation predicted or transferred from N315 and NCTC 8325 [2]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p) - ↑ Hannes Wolfgramm, Larissa Milena Busch, Jöran Tebben, Henry Mehlan, Lisa Hagenau, Thomas Sura, Tilly Hoffmüller, Elisa Bludau, Manuela Gesell Salazar, Alexander Reder, Stephan Michalik, Leif Steil, Kristin Surmann, Ulrike Mäder, Silva Holtfreter, Uwe Völker
Integrated genomic and proteomic analysis of the mouse-adapted Staphylococcus aureus strain JSNZ.
Curr Res Microb Sci: 2025, 9;100489
[PubMed:41146725] [WorldCat.org] [DOI] (I e)