Jump to navigation
Jump to search
FunGene: 08-OCT-2024
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: JSNZ_001327
- pan locus tag?: SAUPAN003718000
- symbol: JSNZ_001327
- pan gene symbol?: —
- synonym:
- product: YneF family protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: JSNZ_001327
- symbol: JSNZ_001327
- product: YneF family protein
- replicon: chromosome
- strand: +
- coordinates: 1334626..1334868
- length: 243
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq:
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGGCAACTTGGTTAGCAATTATTTTTATAGTAGCTGCATTAATTTTAGGTTTAATTGGA
GGTTTCCTTTTAGCTAGAAAATATATGATGGACTACTTGAAGAAAAACCCACCAATCAAC
GAAGAAATGCTTCGTATGATGATGATGCAAATGGGTCAAAAACCTTCTCAGAAGAAAATT
AATCAAATGATGACGATGATGAATAAAAATATGGATCAAAATATGAAGAGTGCGAAAAAG
TAA60
120
180
240
243
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: JSNZ_001327
- symbol: JSNZ_001327
- description: YneF family protein
- length: 80
- theoretical pI: 10.8463
- theoretical MW: 9319.56
- GRAVY: -0.03
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: no clan defined UPF0154; Uncharacterised protein family (UPF0154) (PF03672; HMM-score: 102.7)and 2 moreCATSPERE_NTD2; CATSPERE second N-terminal domain (PF22843; HMM-score: 16.3)E-set (CL0159) DUF4179; Domain of unknown function (DUF4179) (PF13786; HMM-score: 15.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9951
- Cell wall & surface Score: 0
- Extracellular Score: 0.0049
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.059004
- TAT(Tat/SPI): 0.001484
- LIPO(Sec/SPII): 0.029154
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq:
- UniProt:
⊟Protein sequence[edit | edit source]
- MATWLAIIFIVAALILGLIGGFLLARKYMMDYLKKNPPINEEMLRMMMMQMGQKPSQKKINQMMTMMNKNMDQNMKSAKK
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- Operon-mapper [1] : JSNZ_001327 > JSNZ_001328
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p)