From AureoWiki
Jump to navigation Jump to search

FunGene: 08-OCT-2024

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: JSNZ_001183
  • pan locus tag?: SAUPAN003497000
  • symbol: JSNZ_001183
  • pan gene symbol?: —
  • synonym:
  • product: TM2 domain-containing protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: JSNZ_001183
  • symbol: JSNZ_001183
  • product: TM2 domain-containing protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1187169..1187372
  • length: 204
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq:
  • BioCyc:
  • MicrobesOnline:

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGCAAGTAAACAAAGTTATTTATATTTTATTAGCATTGTTCTTAGGTAGTTTTGGTATT
    CATAAATTTTATGCCGGCAAGAATATGCAAGGTATTCTACACTTAATATTCTGTTGGACA
    GGTATCCCACACATTTTAGCAATTATTAGTGCGATAATTACTGTTTTCAAACCAGCTGAC
    GAACATGGTAATGTTACATTATAA
    60
    120
    180
    204

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: JSNZ_001183
  • symbol: JSNZ_001183
  • description: TM2 domain-containing protein
  • length: 67
  • theoretical pI: 9.23841
  • theoretical MW: 7451.94
  • GRAVY: 0.9

⊟Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    no clan defined TM2; TM2 domain (PF05154; HMM-score: 68.8)
    and 1 more
    Borrelia_P13; Borrelia membrane protein P13 (PF05628; HMM-score: 13.5)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.001
    • Cytoplasmic Membrane Score: 0.9268
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.0721
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.032407
    • TAT(Tat/SPI): 0.000444
    • LIPO(Sec/SPII): 0.040638
  • predicted transmembrane helices (TMHMM): 2

⊟Accession numbers[edit | edit source]

  • GI:
  • RefSeq:
  • UniProt:

⊟Protein sequence[edit | edit source]

  • MQVNKVIYILLALFLGSFGIHKFYAGKNMQGILHLIFCWTGIPHILAIISAIITVFKPADEHGNVTL

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=JSNZ_001183&oldid=106824"