From AureoWiki
Jump to navigation Jump to search

FunGene: 08-OCT-2024

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: JSNZ_000987
  • pan locus tag?: SAUPAN003212000
  • symbol: JSNZ_000987
  • pan gene symbol?:
  • synonym:
  • product: IDEAL domain-containing protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: JSNZ_000987
  • symbol: JSNZ_000987
  • product: IDEAL domain-containing protein
  • replicon: chromosome
  • strand: +
  • coordinates: 995444..995662
  • length: 219
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq:
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGAAATACAATACTAATGTTAAACATACAACTTTAGAAGCGTTTGTCACAACTGTCAAT
    GATTTGGGTATTGAATTAATTATCAATGAAGCACTTCGAGAGGTAAGAAAACGACAGCTC
    ATAGAACTTATAGATGACGCACTCGTCAATAAAGATGAAGCAGCATTTAATCAATATACG
    GCAGAATACAAAAATTTGGAGGCATTTCTCGGTGAATAA
    60
    120
    180
    219

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: JSNZ_000987
  • symbol: JSNZ_000987
  • description: IDEAL domain-containing protein
  • length: 72
  • theoretical pI: 4.41444
  • theoretical MW: 8302.34
  • GRAVY: -0.298611

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    no clan defined IDEAL; IDEAL domain (PF08858; HMM-score: 50.6)
    and 3 more
    Ac76; Orf76 (Ac76) (PF05814; HMM-score: 13.3)
    DarP; Dual-action ribosomal maturation protein DarP (PF04751; HMM-score: 13.2)
    DUF4903; Domain of unknown function (DUF4903) (PF16246; HMM-score: 13.2)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9306
    • Cytoplasmic Membrane Score: 0.0274
    • Cell wall & surface Score: 0.0032
    • Extracellular Score: 0.0388
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003559
    • TAT(Tat/SPI): 0.000123
    • LIPO(Sec/SPII): 0.000257
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq:
  • UniProt:

Protein sequence[edit | edit source]

  • MKYNTNVKHTTLEAFVTTVNDLGIELIINEALREVRKRQLIELIDDALVNKDEAAFNQYTAEYKNLEAFLGE

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator: CodY (repression) regulon
    CodY(TF)important in Amino acid metabolism;  transcription unit predicted or transferred from N315 and NCTC8325 

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]