Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_0929 [new locus tag: SAUSA300_RS04990 ]
- pan locus tag?: SAUPAN003212000
- symbol: SAUSA300_0929
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_0929 [new locus tag: SAUSA300_RS04990 ]
- symbol: SAUSA300_0929
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 1019846..1020064
- length: 219
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3915262 NCBI
- RefSeq: YP_493627 NCBI
- BioCyc: see SAUSA300_RS04990
- MicrobesOnline: 1292444 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGAAATACAATACTAATGTTAAACATACAACTTTAGAAGCGTTTGTCACAACTGTCAAT
GATTTGGGTATTGAATTAATTATCAATGAAGCACTTCGAGAGGTAAGAAAACGACAGCTC
ATAGAACTTATAGATGACGCACTCGTCAATAAAGATGAAGCAGCATTTAATCAATATACG
GCAGAATACAAAAATTTGGAGGCATTTCTCGGTGAATAA60
120
180
219
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_0929 [new locus tag: SAUSA300_RS04990 ]
- symbol: SAUSA300_0929
- description: hypothetical protein
- length: 72
- theoretical pI: 4.41444
- theoretical MW: 8302.34
- GRAVY: -0.298611
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- FIG01108449: hypothetical protein
- PFAM: no clan defined IDEAL; IDEAL domain (PF08858; HMM-score: 50.6)and 3 moreAc76; Orf76 (Ac76) (PF05814; HMM-score: 13.3)DarP; Dual-action ribosomal maturation protein DarP (PF04751; HMM-score: 13.2)DUF4903; Domain of unknown function (DUF4903) (PF16246; HMM-score: 13.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9306
- Cytoplasmic Membrane Score: 0.0274
- Cell wall & surface Score: 0.0032
- Extracellular Score: 0.0388
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003559
- TAT(Tat/SPI): 0.000123
- LIPO(Sec/SPII): 0.000257
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKYNTNVKHTTLEAFVTTVNDLGIELIINEALREVRKRQLIELIDDALVNKDEAAFNQYTAEYKNLEAFLGE
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator: CodY (repression) regulon
CodY (TF) important in Amino acid metabolism; RegPrecise
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]