Jump to navigation
Jump to search
FunGene: 08-OCT-2024
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: JSNZ_000844
- pan locus tag?: SAUPAN002965000
- symbol: JSNZ_000844
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: JSNZ_000844
- symbol: JSNZ_000844
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 852058..852204
- length: 147
- essential: unknown
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq:
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGATGTGGTTAGTCATAGCAATTATATTACTAGTCATCTTATTGTTTGGTGTGATGTTG
CAAGCTGAACAGTTAAAAGGCGATGTGAAAGTTAAAGAGCGGGAGATAGAGATATTAAGA
AGTAGATTGAGACATTTTGAAGATTAA60
120
147
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: JSNZ_000844
- symbol: JSNZ_000844
- description: hypothetical protein
- length: 48
- theoretical pI: 7.55167
- theoretical MW: 5706.95
- GRAVY: 0.629167
⊟Function[edit | edit source]
- TIGRFAM: Protein fate Protein folding and stabilization cytochrome c-type biogenesis protein CcmI (TIGR03142; HMM-score: 16.3)Energy metabolism Electron transport cytochrome c-type biogenesis protein CcmI (TIGR03142; HMM-score: 16.3)and 1 moreheme exporter protein CcmD (TIGR03141; HMM-score: 12.7)
- TheSEED:
- PFAM: no clan defined DUF1514; Protein of unknown function (DUF1514) (PF07438; HMM-score: 8.2)Ibs_toxin; Toxin Ibs, type I toxin-antitoxin system (PF13956; HMM-score: 6.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0026
- Cytoplasmic Membrane Score: 0.9629
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.0344
- LocateP:
- SignalP: Signal peptide SP(Sec/SPI) length 22 aa
- SP(Sec/SPI): 0.56121
- TAT(Tat/SPI): 0.002563
- LIPO(Sec/SPII): 0.111567
- Cleavage Site: CS pos: 22-23. LQA-EQ. Pr: 0.4772
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq:
- UniProt:
⊟Protein sequence[edit | edit source]
- MMWLVIAIILLVILLFGVMLQAEQLKGDVKVKEREIEILRSRLRHFED
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- Operon-mapper [1] : JSNZ_000832 > JSNZ_000833 > JSNZ_000834 > JSNZ_000835 > JSNZ_000836 > JSNZ_000837 > JSNZ_000838 > JSNZ_000839 > JSNZ_000840 > JSNZ_000841 > JSNZ_000842 > JSNZ_000843 > JSNZ_000844 > JSNZ_000845
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p)